GATD3A Antibody (1F5) - Azide and BSA Free

Novus Biologicals | Catalog # H00008209-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1F5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK

Specificity

C21orf33 - chromosome 21 open reading frame 33

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for GATD3A Antibody (1F5) - Azide and BSA Free

Western Blot: GATD3A Antibody (1F5) [H00008209-M01]

Western Blot: GATD3A Antibody (1F5) [H00008209-M01]

Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: GATD3A Antibody (1F5) [H00008209-M01]

Immunocytochemistry/ Immunofluorescence: GATD3A Antibody (1F5) [H00008209-M01]

Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GATD3A Antibody (1F5) [H00008209-M01]

Immunohistochemistry-Paraffin: GATD3A Antibody (1F5) [H00008209-M01]

Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: GATD3A Antibody (1F5) [H00008209-M01]

Western Blot: GATD3A Antibody (1F5) [H00008209-M01]

Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of C21orf33 expression in transfected 293T cell line by C21orf33 monoclonal antibody (M01), clone 1F5.Lane 1: C21orf33 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: C21orf33 Antibody (1F5) [H00008209-M01] - Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.

Applications for GATD3A Antibody (1F5) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GATD3A

Alternate Names

chromosome 21 open reading frame 33, D21S2048E, ES1, GT335, HES1, HES1KNP-Ia, human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335, Keio novel protein I, KNPH, KNPI, KNP-I, KNPImitochondrial, Protein KNP-I

Entrez Gene IDs

8209 (Human)

Gene Symbol

GATD3

OMIM

601659 (Human)

Additional GATD3A Products

Product Documents for GATD3A Antibody (1F5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GATD3A Antibody (1F5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GATD3A Antibody (1F5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GATD3A Antibody (1F5) - Azide and BSA Free and earn rewards!

Have you used GATD3A Antibody (1F5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...