GCC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83610

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GCC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610] - Staining of human liver.
Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610] - Staining of human colon, kidney, liver and testis using Anti-GCC1 antibody NBP1-83610 (A) shows similar protein distribution across tissues to independent antibody NBP1-83609 (B).
Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610] - Staining of human colon.
Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610] - Staining of human kidney.
Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610]

Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83610] - Staining of human testis.
GCC1 Antibody - BSA Free Western Blot: GCC1 Antibody - BSA Free [NBP1-83610]

Western Blot: GCC1 Antibody - BSA Free [NBP1-83610]

Analysis in U-138MG cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GCC1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
GCC1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: GCC1 Antibody [NBP1-83610]

Immunocytochemistry/ Immunofluorescence: GCC1 Antibody [NBP1-83610]

Staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.

Applications for GCC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCC1

GCC1 is encoded by this gene is a peripheral membrane protein. It is sensitive to brefeldin A. This encoded protein contains a GRIP domain which is thought to be used in targeting. It may play a role in the organization of trans-Golgi network subcompartment involved with membrane transport. [provided by RefSeq]

Alternate Names

FLJ22035, GCC1P, GCC88Golgi coiled-coil protein 1, golgi coiled-coil 1, GRIP and coiled-coil domain containing 1, GRIP and coiled-coil domain-containing protein 1, MGC20706, peripheral membrane Golgi protein

Gene Symbol

GCC1

Additional GCC1 Products

Product Documents for GCC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GCC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCC1 Antibody - BSA Free and earn rewards!

Have you used GCC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...