GDF-15 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81050
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for GDF-15 Antibody - BSA Free
Western Blot: GDF-15 Antibody [NBP1-81050]
Western Blot: GDF-15 Antibody [NBP1-81050] - Analysis in human cell line BEWO.Immunocytochemistry/ Immunofluorescence: GDF-15 Antibody [NBP1-81050]
Immunocytochemistry/Immunofluorescence: GDF-15 Antibody [NBP1-81050] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050]
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human prostate shows moderate cytoplasmic positivity in a small subset of glandular cells.Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050]
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050]
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.Immunohistochemistry: GDF-15 Antibody - BSA Free [NBP1-81050] -
GDF‐15 expression is modulated by ROS‐induced p53 activation. (A) Relative release of GDF‐15 at 7 days and 14 days after ex vivo cartilage trauma of untreated or NAC‐treated explants. (B) Gene expression of GDF15 and (C, D) detection of intracellular ROS levels by DCFDA assay in isolated hAC upon H2O2 exposure for 48 h. (E) Release of GDF‐15 by H2O2‐treated hAC with or without treatment of NAC. (F) Representative images of IF staining of p53 in H2O2‐treated hAC. (G) Correlation analysis between CTCF values of p53 staining and GDF‐15 concentrations of unstimulated or H2O2‐treated hAC. (H) Quantification of posttraumatic p53 activation (detected by means of IHC) and effects of antioxidative therapy by NAC at 7 days after ex vivo cartilage trauma. Gene expression analysis of GDF‐15 in hAC after stimulation with (I) the MDM2 antagonist (p53 inducing) Nutlin‐3a and (J) the inhibitor of p53 transcription activity, Pifithrin‐ alpha or Pifithrin‐μ. (K) Representative images of IHC staining against p53 and GDF‐15 in human cartilage and (L) corresponding correlation analysis. The white bars in (C) and (F) represent 100 um. The black bars in (K) represent 200 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/41287825), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for GDF-15 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GDF-15
GDF15 antibodies are useful for studies on inflamation and immune system research.
Long Name
Growth Differentiation Factor 15
Alternate Names
GDF15, MIC-1, NAG-1, PDF, PLAB, PTGF-beta
Entrez Gene IDs
9518 (Human)
Gene Symbol
GDF15
UniProt
Additional GDF-15 Products
Product Documents for GDF-15 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GDF-15 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for GDF-15 Antibody - BSA Free
Customer Reviews for GDF-15 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GDF-15 Antibody - BSA Free and earn rewards!
Have you used GDF-15 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...