Glutaminase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89766

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Mouse, Rat

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25798620). Rat reactivity reported in scientific literature (PMID: 31265816).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutaminase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Glutaminase Antibody [NBP1-89766]

Immunocytochemistry/ Immunofluorescence: Glutaminase Antibody [NBP1-89766]

Immunocytochemistry/Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining of human cell line SiHa shows localization to mitochondria. Antibody staining is shown in green.
Glutaminase Antibody - BSA Free Western Blot: Glutaminase Antibody - BSA Free [NBP1-89766]

Western Blot: Glutaminase Antibody - BSA Free [NBP1-89766]

Analysis in human cell line EFO-21.
Western Blot: Glutaminase Antibody [NBP1-89766]

Western Blot: Glutaminase Antibody [NBP1-89766]

Glutaminase-Antibody-Western-Blot-NBP1-89766-img0016.jpg
Glutaminase Antibody

Western Blot: Glutaminase Antibody [NBP1-89766] -

Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Glutaminase Antibody

Western Blot: Glutaminase Antibody [NBP1-89766] -

Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Glutaminase Antibody

Western Blot: Glutaminase Antibody [NBP1-89766] -

Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Glutaminase Antibody - BSA Free Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Analysis in human kidney and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.
Glutaminase Antibody - BSA Free Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Glutaminase Antibody - BSA Free Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Glutaminase Antibody - BSA Free Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Glutaminase Antibody - BSA Free Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]

Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Applications for Glutaminase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutaminase

Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]

Long Name

Glutaminase Kidney Isoform, Mitochondrial

Alternate Names

GLS, K-Glutaminase, L-Glutamine Amidohydrolase

Gene Symbol

GLS

Additional Glutaminase Products

Product Documents for Glutaminase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutaminase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Glutaminase Antibody - BSA Free

Customer Reviews for Glutaminase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutaminase Antibody - BSA Free and earn rewards!

Have you used Glutaminase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...