Glutathione Synthetase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30465

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glutathione Synthetase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione Synthetase Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Analysis in human epididymis and skeletal muscle tissues using NBP2-30465antibody. Corresponding GSS RNA-seq data are presented for the same tissues
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human fallopian tube, gastrointestinal, prostate and skeletal muscle using Anti-GSS antibody NBP2-30465 (A) shows similar protein distribution across tissues to independent antibody.
Western Blot: Glutathione Synthetase Antibody [NBP2-30465]

Western Blot: Glutathione Synthetase Antibody [NBP2-30465]

Western Blot: Glutathione Synthetase Antibody [NBP2-30465] - Analysis using Anti-GSS antibody NBP2-30465 (A) shows similar pattern to independent antibody NBP2-57177 (B).
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody [NBP2-30465]

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody [NBP2-30465]

Immunocytochemistry/Immunofluorescence: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465]

Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Applications for Glutathione Synthetase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione Synthetase

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage byfree radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as ahomodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion ofgamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.(provided by RefSeq)

Alternate Names

EC 6.3.2.3, Glutathione synthase, glutathione synthetase, GSH synthetase, GSHS, GSH-S, MGC14098

Gene Symbol

GSS

UniProt

P48637 (Human)

Additional Glutathione Synthetase Products

Product Documents for Glutathione Synthetase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glutathione Synthetase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutathione Synthetase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione Synthetase Antibody - BSA Free and earn rewards!

Have you used Glutathione Synthetase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies