Glypican 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-36558

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for Glypican 3 antibody: synthetic peptide directed towards the middle region of human Glypican 3. Peptide sequence: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glypican 3 Antibody - BSA Free

Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558] - Host: Rabbit. Target Name: GPC3. Sample Tissue: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: Glypican 3 Antibody [NBP2-36558]

Immunohistochemistry: Glypican 3 Antibody [NBP2-36558]

Immunohistochemistry: Glypican 3 Antibody [NBP2-36558] - Paraffin Embedded Tissue: Human Placenta cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558] - Sample Tissue: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558] - Reccomended Titration: 2.5 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Placenta
Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558]

Western Blot: Glypican 3 Antibody [NBP2-36558] - Host: Rabbit. Target: GPC3. Positive control (+): Human lung (LU). Negative control (-): Human heart (HE). Antibody concentration: 1ug/ml

Applications for Glypican 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

4.0 - 8.0 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glypican 3

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

Alternate Names

GPC3

Entrez Gene IDs

2719 (Human)

Gene Symbol

GPC3

UniProt

Additional Glypican 3 Products

Product Documents for Glypican 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glypican 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glypican 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glypican 3 Antibody - BSA Free and earn rewards!

Have you used Glypican 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies