GM130/GOLGA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89756

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE

Marker

Golgi Apparatus Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GM130/GOLGA2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756]

Immunocytochemistry/ Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756]

Immunocytochemistry/Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
GM130/GOLGA2 Antibody - BSA Free Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Staining of human gastrointestinal, placenta, prostate and squamous epithelia using Anti-GOLGA2 antibody NBP1-89756 (A) shows similar protein distribution across tissues to independent antibody NBP1-89757 (B).
GM130/GOLGA2 Antibody - BSA Free Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Staining of human cervix, uterine shows strong granular cytoplasmic positivity in squamous epithelial cells.
GM130/GOLGA2 Antibody - BSA Free Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
GM130/GOLGA2 Antibody - BSA Free Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
GM130/GOLGA2 Antibody - BSA Free Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody - BSA Free [NBP1-89756]

Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Western Blot: GM130/GOLGA2 Antibody [NBP1-89756]

Western Blot: GM130/GOLGA2 Antibody [NBP1-89756]

Western Blot: GM130/GOLGA2 Antibody [NBP1-89756] - Analysis using Anti-GOLGA2 antibody NBP1-89756 (A) shows similar pattern to independent antibody NBP1-89758 (B).

Applications for GM130/GOLGA2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GM130/GOLGA2

Golgi Matrix Protein (GM130) is peripheral cytoplamic protein that is bound to the Golgi membranes. It has been implicated as a maintainer of cis-Golgi structure (1). During mitosis, it regulates the disassembly and reassembly of the Golgi complex. It is also linked to docking and fusion of coatomer (COP I) coated vesicles to the Golgi membrane (2). The COOH-terminal domain of GM130 is highly homologous to Golgi human auto-antigen, golgin-95. GM130 interacts specifically and GTP-dependent manner with Rab1b protein, a regulator of anterograde traffic between ER and Golgi membranes (3). GM130 is also activator of YSK1, an essential player in cell migration.

Long Name

Golgin A2

Alternate Names

GOLGA2, Golgin-95, SY11 Protein

Gene Symbol

GOLGA2

Additional GM130/GOLGA2 Products

Product Documents for GM130/GOLGA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GM130/GOLGA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for GM130/GOLGA2 Antibody - BSA Free

Customer Reviews for GM130/GOLGA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GM130/GOLGA2 Antibody - BSA Free and earn rewards!

Have you used GM130/GOLGA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...