GMF-beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89755

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26101216).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GMF-beta Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755]

Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755]

Immunocytochemistry/Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.
GMF-beta Antibody - BSA Free Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Staining of mouse cerebellum shows strong positivity in Purkinje cells.
GMF-beta Antibody - BSA Free Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Staining of mouse brain shows strong positivity in neurons and dendrites in cerebral cortex.
GMF-beta Antibody - BSA Free Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
GMF-beta Antibody - BSA Free Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
GMF-beta Antibody - BSA Free Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
GMF-beta Antibody - BSA Free Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Immunohistochemistry-Paraffin: GMF-beta Antibody - BSA Free [NBP1-89755]

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
GMF-beta Antibody - BSA Free Western Blot: GMF-beta Antibody - BSA Free [NBP1-89755]

Western Blot: GMF-beta Antibody - BSA Free [NBP1-89755]

Analysis in human cell line A-431.
GMF-beta Antibody - BSA Free Western Blot: GMF-beta Antibody - BSA Free [NBP1-89755]

Western Blot: GMF-beta Antibody - BSA Free [NBP1-89755]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755]

Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755]

GMF-beta-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89755-img0020.jpg
Immunohistochemistry: GMF-beta Antibody [NBP1-89755]

Immunohistochemistry: GMF-beta Antibody [NBP1-89755]

GMF-beta-Antibody-Immunohistochemistry-NBP1-89755-img0019.jpg
GMF-beta Antibody

Immunohistochemistry: GMF-beta Antibody [NBP1-89755] -

Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta knockdown suppresses tumor growth & the formation of human-CD31 positive microvessels (hCD31-MVs) in orthotopic U87 xenograft modelsA. The cross-sectional appearance of xenografted gliomas from U87-mock group B. The cross-sectional appearance of xenografted gliomas from U87-shGMF-beta group. Gross tumor boundaries were delineated by white dotlines. C. A hCD31-microvessel & several hCD31-negative vessels in U87-mock tumor. D. No hCD31-MVs, only hCD31-negative vessels in U87-shGMF-beta tumor. Red solid arrows indicate hGMF-beta staining in tumor cells, black solid arrows show hCD31 staining on microvasular endothelia, & open arrows denote vessels negative for hCD31. Scale bar: 100 μm in upper pannels; 50 μm in lower pannels. E. Quantitative comparisons of gross tumor volume between U87-mock & U87-shGMF-beta group. F. Quantitative comparisons of hCD31-microvessel densities (MVDs) between U87-mock & U87-shGMF-beta group. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Western Blot: GMF-beta Antibody [NBP1-89755]

Western Blot: GMF-beta Antibody [NBP1-89755]

GMF-beta-Antibody-Western-Blot-NBP1-89755-img0022.jpg
Knockdown Validated: GMF-beta Antibody [NBP1-89755]

Western Blot: GMF-beta Antibody [NBP1-89755]

GMF-beta-Antibody-Knockdown-Validated-NBP1-89755-img0021.jpg
GMF-beta Antibody

Western Blot: GMF-beta Antibody [NBP1-89755] -

Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdownA. Protein levels of GMF-beta in human glial cell line (HEB) & human glioma cell lines of the different grades (CHG5, SHG44, U87). B. Assessment of GMF-beta knockdown in U87 cells by western blotting. C. Tube formation by U87 mock cells (left panel); impaired tube formation by U87-shGMF-beta cells (right panel). Inspection under a phase contrast fluorescent microscope (× 100). D. Quantified tubulogenesis of U87 mock cells & U87-shGMF-beta cells by pattern recognition system (left panel) & branch point counting system (right panel).*** indicates significant difference with P < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GMF-beta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GMF-beta

This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition ofproliferation of tumor cells

Long Name

Glia Maturation Factor beta

Alternate Names

GMFB, GMFbeta

Entrez Gene IDs

2764 (Human); 63985 (Mouse)

Gene Symbol

GMFB

UniProt

Additional GMF-beta Products

Product Documents for GMF-beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GMF-beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for GMF-beta Antibody - BSA Free

Customer Reviews for GMF-beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GMF-beta Antibody - BSA Free and earn rewards!

Have you used GMF-beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GMF-beta Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I am interested in purchasing this antibody (glial maturation factor-beta) but I have a trivial question before. As far as I know, gmf-beta has being described as an astrocytic factor, therefore I am quite puzzled observing the IHC that you reported. In fact, the signal appear concentrated in the soma (or nucleus) of some neurons. How do you justify that? Do you expect such a staining?

    A:

    Based on what we know about this protein, we are seeing the expected staining pattern. Please see other instances of nuclear staining at the human protein atlas informational site (https://www.proteinatlas.org/ENSG00000197045-GMFB/subcellular). I think you may find it useful. Please let me know if you have any additional questions, technical@novusbio.com.

  • Q: I am sure that based on your knowledge you are seeing the expected staining pattern. What concerns me is that the literature on gmf-beta is very poor and it all describes a maturation factor produced in astrocytes and retained in the cytosol. Could you please give me some reference to justify the fact that the signal is not in astrocytes but in neurons?

    A:

    Here is the information that I received from the lab: We have tested this antibody (Anti-GMFB) in different tissues and have indeed seen some staining of glia cells as well. The image chosen to represent this product shows staining of neurons, and we believe this staining pattern to be accurate and representative based on the comment in UniProt regarding the function for this target: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. (https://www.uniprot.org/uniprotkb/P60983/entry) Expression of this protein in neurons is also described in the following article; Wang et al. Polyclonal antibody localizes glia maturation factor fl-like immunoreactivity in neurons and glia, Brain Research, 591 (1992) 1-7 (PubMed ID 1446220).

  • Q: I am interested in purchasing this antibody (glial maturation factor-beta) but I have a trivial question before. As far as I know, gmf-beta has being described as an astrocytic factor, therefore I am quite puzzled observing the IHC that you reported. In fact, the signal appear concentrated in the soma (or nucleus) of some neurons. How do you justify that? Do you expect such a staining?

    A:

    Based on what we know about this protein, we are seeing the expected staining pattern. Please see other instances of nuclear staining at the human protein atlas informational site (https://www.proteinatlas.org/ENSG00000197045-GMFB/subcellular). I think you may find it useful. Please let me know if you have any additional questions, technical@novusbio.com.

  • Q: I am sure that based on your knowledge you are seeing the expected staining pattern. What concerns me is that the literature on gmf-beta is very poor and it all describes a maturation factor produced in astrocytes and retained in the cytosol. Could you please give me some reference to justify the fact that the signal is not in astrocytes but in neurons?

    A:

    Here is the information that I received from the lab: We have tested this antibody (Anti-GMFB) in different tissues and have indeed seen some staining of glia cells as well. The image chosen to represent this product shows staining of neurons, and we believe this staining pattern to be accurate and representative based on the comment in UniProt regarding the function for this target: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. (https://www.uniprot.org/uniprotkb/P60983/entry) Expression of this protein in neurons is also described in the following article; Wang et al. Polyclonal antibody localizes glia maturation factor fl-like immunoreactivity in neurons and glia, Brain Research, 591 (1992) 1-7 (PubMed ID 1446220).

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...