GOLGA5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83352
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:31628189).
Marker
Golgi Apparatus Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for GOLGA5 Antibody - BSA Free
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebellum, epididymis, stomach and testis using Anti-GOLGA5 antibody NBP1-83352 (A) shows similar protein distribution across tissues to independent antibody NBP2-39007 (B).Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352]
Immunocytochemistry/Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse motor cortex shows strong cytoplasmic immunoreactivity in neurons.Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse thalamus shows positivity in neuronal cell bodies in ventral anterior nucleus.Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the CA3 area.Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse mesencephalic reticular formation shows strong immunoreactivity in a subset of neurons.Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human epididymis shows strong positivity in Golgi apparatus in glandular cells.Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: GOLGA5 Antibody - BSA Free [NBP1-83352]
Staining of mouse globus pallidus shows positivity in neuronal cell bodies.Western Blot: GOLGA5 Antibody - BSA Free [NBP1-83352] -
Hep-EVs reveals enhanced release with proliferative information during liver regeneration. (A) Flow cytometric analysis showing ASGPR surface expression on LT-EVs before and after immunomagnetic sorting. (B) Size distribution of LT-EVs analyzed by NTA. (C) Quantification of particle number of LT-EVs by NTA and protein amount of LT-EVs determined by the BCA assay. Mean +/- SD. n = 3 per group. *, p < 0.05; ***, p < 0.001; one-way ANOVA with Turkey’s post-hoc tests. (D) Representative TEM image of LT-EVs from Sham and PHx livers. Bars = 250 nm. (E) Size distribution of sorted Hep-EVs analyzed by NTA. (F) Quantification of particle number of sorted Hep-EVs by NTA and protein amount determined by the BCA assay. Mean +/- SD. n = 3 per group. ***, p < 0.001; ****, p < 0.0001; one-way ANOVA with Turkey’s post-hoc tests. (G) Venn diagram of proteome of PHx and Sham Hep-EVs. (H) Volcano plot of proteome of PHx and Sham Hep-EVs. (I) GO terms in the Cellular Component category of DEPs enriched in PHx over Sham Hep-EVs. (J) Western blot analysis of protein marker expression of LT-EVs and Hep-EVs. (K) Top-ranked DEPs of interest in Hep-EVs and Western blot validation of expression Image collected and cropped by CiteAb from the following open publication (https://jnanobiotechnology.biomedcentral.com/articles/10.1186/s12951-02…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for GOLGA5 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GOLGA5
Alternate Names
Cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgin A5, Golgin subfamily A member 5, golgin-84, GOLIM5, Protein Ret-II, PTC5, RET-fused gene 5 protein, RETII, ret-II, rfg5, RFG5golgi integral membrane protein 5
Gene Symbol
GOLGA5
Additional GOLGA5 Products
Product Documents for GOLGA5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GOLGA5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for GOLGA5 Antibody - BSA Free
Customer Reviews for GOLGA5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GOLGA5 Antibody - BSA Free and earn rewards!
Have you used GOLGA5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...