GRSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89488

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GRSF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GRSF1 Antibody [NBP1-89488]

Immunocytochemistry/ Immunofluorescence: GRSF1 Antibody [NBP1-89488]

Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP1-89488] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human adrenal gland, colon, lymph node and pancreas using Anti-GRSF1 antibody NBP1-89488 (A) shows similar protein distribution across tissues to independent antibody NBP2-38341 (B).
Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human adrenal gland.
Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
GRSF1 Antibody - BSA Free Immunohistochemistry-Paraffin: GRSF1 Antibody - BSA Free [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody - BSA Free [NBP1-89488]

Staining of human testis shows weak to moderate granular cytoplasmic positivity in cells in seminiferous ducts.
GRSF1 Antibody - BSA Free Immunohistochemistry-Paraffin: GRSF1 Antibody - BSA Free [NBP1-89488]

Immunohistochemistry-Paraffin: GRSF1 Antibody - BSA Free [NBP1-89488]

Staining of human pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans.
Western Blot: GRSF1 Antibody [NBP1-89488]

Western Blot: GRSF1 Antibody [NBP1-89488]

Western Blot: GRSF1 Antibody [NBP1-89488] - Analysis using Anti-GRSF1 antibody NBP1-89488 (A) shows similar pattern to independent antibody NBP2-38341 (B).
GRSF1 Antibody - BSA Free Western Blot: GRSF1 Antibody - BSA Free [NBP1-89488]

Western Blot: GRSF1 Antibody - BSA Free [NBP1-89488]

Analysis in human cell line MOLT-4.

Applications for GRSF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRSF1

The GRSF1 gene encodes a sequence factor 1 protein that plays a role in binding RNAs that contain the 14 base G-rich element. This protein is located in the cytoplasm and encourages transmission of viral mRNAs in vitro. It codes for two isoforms: Isoform 1 is 480 amino acids long at 53 kDA while isoform 2 is 318 amino acids long at a mass of approximately 36 kDA. The GRSF1 gene interacts with the ICT1, FTSJ1, APC, ULK2, and GABARAP genes. Research on influenza and neuronitis have explored the role of GRSF1 in the development of these diseases.

Alternate Names

FLJ13125, G-rich RNA sequence binding factor 1, G-rich sequence factor 1, GRSF-1

Gene Symbol

GRSF1

Additional GRSF1 Products

Product Documents for GRSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GRSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRSF1 Antibody - BSA Free and earn rewards!

Have you used GRSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...