GSTT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35280

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of GSTT1 (NP_000844.2).

Sequence:
YWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GSTT1 Antibody - BSA Free

GSTT1 Antibody

Immunohistochemistry: GSTT1 Antibody [NBP3-35280] -

Immunohistochemistry: GSTT1 Antibody [NBP3-35280] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using GSTT1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
GSTT1 Antibody

Immunohistochemistry: GSTT1 Antibody [NBP3-35280] -

Immunohistochemistry: GSTT1 Antibody [NBP3-35280] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using GSTT1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
GSTT1 Antibody

Immunohistochemistry: GSTT1 Antibody [NBP3-35280] -

Immunohistochemistry: GSTT1 Antibody [NBP3-35280] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using GSTT1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
GSTT1 Antibody

Western Blot: GSTT1 Antibody [NBP3-35280] -

Western Blot: GSTT1 Antibody [NBP3-35280] - Western blot analysis of lysates from HepG2 cells, using GSTT1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
GSTT1 Antibody

Immunocytochemistry/ Immunofluorescence: GSTT1 Antibody [NBP3-35280] -

Immunocytochemistry/ Immunofluorescence: GSTT1 Antibody [NBP3-35280] - Immunofluorescence analysis of L929 cells using GSTT1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for GSTT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GSTT1

Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugationof reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into fivemain classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55%amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. TheGSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure,being composed of five exons with identical exon/intron boundaries. (provided by RefSeq)

Alternate Names

EC 2.5.1.18, glutathione S-transferase theta 1, glutathione S-transferase theta-1, Glutathione transferase T1-1, GST class-theta-1

Gene Symbol

GSTT1

Additional GSTT1 Products

Product Documents for GSTT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSTT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSTT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSTT1 Antibody - BSA Free and earn rewards!

Have you used GSTT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...