GTPBP9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35182

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human GTPBP9 (NP_037473.3).

Sequence:
DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GTPBP9 Antibody - BSA Free

GTPBP9 Antibody

Immunohistochemistry: GTPBP9 Antibody [NBP3-35182] -

Immunohistochemistry: GTPBP9 Antibody [NBP3-35182] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using GTPBP9 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GTPBP9 Antibody

Immunohistochemistry: GTPBP9 Antibody [NBP3-35182] -

Immunohistochemistry: GTPBP9 Antibody [NBP3-35182] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using GTPBP9 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GTPBP9 Antibody

Immunocytochemistry/ Immunofluorescence: GTPBP9 Antibody [NBP3-35182] -

Immunocytochemistry/ Immunofluorescence: GTPBP9 Antibody [NBP3-35182] - Immunofluorescence analysis of PC-12 cells using GTPBP9 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GTPBP9 Antibody

Western Blot: GTPBP9 Antibody [NBP3-35182] -

Western Blot: GTPBP9 Antibody [NBP3-35182] - Western blot analysis of various lysates using GTPBP9 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
GTPBP9 Antibody

Immunocytochemistry/ Immunofluorescence: GTPBP9 Antibody [NBP3-35182] -

Immunocytochemistry/ Immunofluorescence: GTPBP9 Antibody [NBP3-35182] - Immunofluorescence analysis of NIH/3T3 cells using GTPBP9 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for GTPBP9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GTPBP9

Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP

Alternate Names

DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004

Gene Symbol

OLA1

Additional GTPBP9 Products

Product Documents for GTPBP9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTPBP9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTPBP9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTPBP9 Antibody - BSA Free and earn rewards!

Have you used GTPBP9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...