Guanylyl Cyclase beta 1 Antibody (5O8D9)
Novus Biologicals | Catalog # NBP3-16248
Recombinant Monoclonal Antibody
![Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248]](https://resources.rndsystems.com/images/products/Guanylyl-Cyclase-beta-1-Antibody-5O8D9-Western-Blot-NBP3-16248-img0003.jpg "Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5O8D9 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (Q02153). MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Guanylyl Cyclase beta 1 Antibody (5O8D9)
Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248]
Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Analysis of extracts of various cell lines, using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (NBP3-16248) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] -
Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] -
Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] -
Confocal imaging of HEL cells using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for Guanylyl Cyclase beta 1 Antibody (5O8D9)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:100 - 1:400
Immunohistochemistry
1:200 - 1:800
Immunohistochemistry-Paraffin
1:200 - 1:800
Western Blot
1:1000 - 1:6000
Reviewed Applications
Read 1 review rated 4 using NBP3-16248 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Guanylyl Cyclase beta 1
Alternate Names
EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit
Gene Symbol
GUCY1B1
Additional Guanylyl Cyclase beta 1 Products
Product Documents for Guanylyl Cyclase beta 1 Antibody (5O8D9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Guanylyl Cyclase beta 1 Antibody (5O8D9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Guanylyl Cyclase beta 1 Antibody (5O8D9)
Powered by Bioz
Customer Reviews for Guanylyl Cyclase beta 1 Antibody (5O8D9) (1)
4 out of 5
1 Customer Rating
Have you used Guanylyl Cyclase beta 1 Antibody (5O8D9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Rat Lung TissueSpecies: RatVerified Customer | Posted 06/23/2025Native rat lung stained for CD31 (green), DAPI (blue) and Gucy1b1 (cyan).
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...