HCC1 Antibody (4G8) - Azide and BSA Free

Novus Biologicals | Catalog # H00009584-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4G8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RNPC2 (NP_909122, 423 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG

Specificity

RNPC2 (4G8)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for HCC1 Antibody (4G8) - Azide and BSA Free

Western Blot: HCC1 Antibody (4G8) [H00009584-M01]

Western Blot: HCC1 Antibody (4G8) [H00009584-M01]

Western Blot: HCC1 Antibody (4G8) [H00009584-M01] - RNPC2 monoclonal antibody (M01), clone 4G8. Analysis of RNPC2 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: HCC1 Antibody (4G8) [H00009584-M01]

Immunocytochemistry/ Immunofluorescence: HCC1 Antibody (4G8) [H00009584-M01]

Immunocytochemistry/Immunofluorescence: HCC1 Antibody (4G8) [H00009584-M01] - Analysis of monoclonal antibody to RNPC2 on HeLa cell. Antibody concentration 40 ug/ml.
Immunohistochemistry-Paraffin: HCC1 Antibody (4G8) [H00009584-M01]

Immunohistochemistry-Paraffin: HCC1 Antibody (4G8) [H00009584-M01]

Immunohistochemistry-Paraffin: HCC1 Antibody (4G8) [H00009584-M01] - Analysis of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 1 ug/ml.
Western Blot: HCC1 Antibody (4G8) [H00009584-M01]

Western Blot: HCC1 Antibody (4G8) [H00009584-M01]

Western Blot: HCC1 Antibody (4G8) [H00009584-M01] - RNPC2 monoclonal antibody (M01), clone 4G8 Analysis of RNPC2 expression in Hela S3 NE.
Western Blot: HCC1 Antibody (4G8) [H00009584-M01]

Western Blot: HCC1 Antibody (4G8) [H00009584-M01]

Western Blot: HCC1 Antibody (4G8) [H00009584-M01] - Analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody (M01), clone 4G8.Lane 1: RBM39 transfected lysate(58.7 KDa).Lane 2: Non-transfected lysate.
ELISA: HCC1 Antibody (4G8) [H00009584-M01]

ELISA: HCC1 Antibody (4G8) [H00009584-M01]

ELISA: HCC1 Antibody (4G8) [H00009584-M01] - Detection limit for recombinant GST tagged RNPC2 is approximately 0.03ng/ml as a capture antibody.

Applications for HCC1 Antibody (4G8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HCC1

The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.

Long Name

RNA-binding protein 39

Alternate Names

CAPER alpha, CAPERalpha, RBM39, RNPC2

Entrez Gene IDs

9584 (Human)

Gene Symbol

RBM39

OMIM

604739 (Human)

Additional HCC1 Products

Product Documents for HCC1 Antibody (4G8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HCC1 Antibody (4G8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HCC1 Antibody (4G8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HCC1 Antibody (4G8) - Azide and BSA Free and earn rewards!

Have you used HCC1 Antibody (4G8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...