HIBADH Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37923

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human HIBADH (NP_689953.1).

Sequence:
ASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HIBADH Antibody - BSA Free

HIBADH Antibody

Immunocytochemistry/ Immunofluorescence: HIBADH Antibody [NBP3-37923] -

Immunocytochemistry/ Immunofluorescence: HIBADH Antibody [NBP3-37923] - Immunofluorescence analysis of L929 cells using HIBADH Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
HIBADH Antibody

Immunohistochemistry: HIBADH Antibody [NBP3-37923] -

Immunohistochemistry: HIBADH Antibody [NBP3-37923] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using HIBADH Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
HIBADH Antibody

Immunocytochemistry/ Immunofluorescence: HIBADH Antibody [NBP3-37923] -

Immunocytochemistry/ Immunofluorescence: HIBADH Antibody [NBP3-37923] - Immunofluorescence analysis of U-2 OS cells using HIBADH Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
HIBADH Antibody

Immunohistochemistry: HIBADH Antibody [NBP3-37923] -

Immunohistochemistry: HIBADH Antibody [NBP3-37923] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using HIBADH Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
HIBADH Antibody

Western Blot: HIBADH Antibody [NBP3-37923] -

Western Blot: HIBADH Antibody [NBP3-37923] - Western blot analysis of various lysates, using HIBADH Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
HIBADH Antibody

Immunocytochemistry/ Immunofluorescence: HIBADH Antibody [NBP3-37923] -

Immunocytochemistry/ Immunofluorescence: HIBADH Antibody [NBP3-37923] - Immunofluorescence analysis of C6 cells using HIBADH Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for HIBADH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HIBADH

3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]

Alternate Names

3-hydroxyisobutyrate dehydrogenase, 3-hydroxyisobutyrate dehydrogenase, mitochondrial, EC 1.1.1,3'-hydroxyisobutyrate dehydrogenase, EC 1.1.1.31, MGC40361, NS5ATP1

Gene Symbol

HIBADH

Additional HIBADH Products

Product Documents for HIBADH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HIBADH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HIBADH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HIBADH Antibody - BSA Free and earn rewards!

Have you used HIBADH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...