Histone H4 [ac Lys5] Antibody (10G1L0)

Novus Biologicals | Catalog # NBP3-33198

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Dot Blot

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 10G1L0
Loading...

Product Specifications

Immunogen

A synthetic acetylated peptide around K5 of human H4 Clustered Histone 1 (P62805).

Sequence:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG

Modification

ac Lys5

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Histone H4 [ac Lys5] Antibody (10G1L0)

Histone H4 [ac Lys5] Antibody (10G1L0)

Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of NIH-3T3 cells using Histone H4 Rabbit mAb.NIH-3T3 cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Histone H4 [ac Lys5] Antibody (10G1L0)

Western Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Western Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Western blot analysis of various lysates using Histone H4 Rabbit mAb at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37C for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Histone H4 [ac Lys5] Antibody (10G1L0)

Dot Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Dot Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Dot-blot analysis of all sorts of peptides using Histone H4 antibody at 1:1000 dilution.
Histone H4 [ac Lys5] Antibody (10G1L0)

Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Histone H4 [ac Lys5] Antibody (10G1L0)

Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Human appendix using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Histone H4 [ac Lys5] Antibody (10G1L0)

Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Histone H4 [ac Lys5] Antibody (10G1L0)

Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of U-2 OS cells using Histone H4 Rabbit mAb.U-2 OS cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Histone H4 [ac Lys5] Antibody (10G1L0)

Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] -

Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of C6 cells using Histone H4 Rabbit mAb.C6 cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Histone H4 [ac Lys5] Antibody (10G1L0)

Application
Recommended Usage

Dot Blot

1:500 - 1:1000

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H4

Histone proteins H3, H4, H2A, and H2B function as building blocks to package eukaryotic DNA into repeating nucleosome units that are folded in higher order chromatin fibers. The nucleosome is composed of an octamer containing a H3/H4 tetramer and two H2A/H2B dimers, surrounded by approximately 146 base pairs of DNA. A diverse and elaborate array of post-translational modifications including acetylation, phosphorylation, methylation, ubiquitination, and ADP-ribosylation occurs on the N-terminal tail domains of histones. Methylation of position-specific lysine residues in histone N termini is a central modification for regulating epigenetic transitions in chromatin. Each methylatable lysine residue can exist in a mono, di, or tri methylated state. Arginine resdiues can also by mono or di methylated.

Alternate Names

H4, H4/M, H4FM, H4M, HIST1H4I, HIST4H4, Histone Cluster 1 H4, Histone Cluster 1 H4i, Histone Cluster 4 H4

Gene Symbol

H4C16

Additional Histone H4 Products

Product Documents for Histone H4 [ac Lys5] Antibody (10G1L0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone H4 [ac Lys5] Antibody (10G1L0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Histone H4 [ac Lys5] Antibody (10G1L0)

There are currently no reviews for this product. Be the first to review Histone H4 [ac Lys5] Antibody (10G1L0) and earn rewards!

Have you used Histone H4 [ac Lys5] Antibody (10G1L0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways
Notch Signaling Pathway Thumbnail