HMGB2 Antibody (8P10V5)

Novus Biologicals | Catalog # NBP3-16774

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8P10V5 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB2 (P26583). MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HMGB2 Antibody (8P10V5)

Western Blot: HMGB2 Antibody (8P10V5) [NBP3-16774]

Western Blot: HMGB2 Antibody (8P10V5) [NBP3-16774]

Western Blot: HMGB2 Antibody (8P10V5) [NBP3-16774] - Analysis of extracts of various cell lines, using HMGB2 Rabbit mAb (NBP3-16774) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunoprecipitation: HMGB2 Antibody (8P10V5) [NBP3-16774]

Immunoprecipitation: HMGB2 Antibody (8P10V5) [NBP3-16774]

Immunoprecipitation: HMGB2 Antibody (8P10V5) [NBP3-16774] - Analysis of 300ug extracts of Mouse testis cells using 3ug HMGB2 antibody (NBP3-16774). Western blot was performed from the immunoprecipitate using HMGB2 (NBP3-16774) at a dilition of 1:1000.
HMGB2 Antibody (8P10V5)

Immunocytochemistry/ Immunofluorescence: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Immunocytochemistry/ Immunofluorescence: HMGB2 Antibody (8P10V5) [NBP3-16774] - Confocal imaging of U-2 OS cells using HMGB2 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
HMGB2 Antibody (8P10V5)

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using HMGB2 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
HMGB2 Antibody (8P10V5)

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using HMGB2 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
HMGB2 Antibody (8P10V5)

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using HMGB2 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
HMGB2 Antibody (8P10V5)

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] - Immunohistochemistry analysis of paraffin-embedded Human colon using HMGB2 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
HMGB2 Antibody (8P10V5)

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Immunohistochemistry: HMGB2 Antibody (8P10V5) [NBP3-16774] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using HMGB2 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
HMGB2 Antibody (8P10V5)

Chromatin Immunoprecipitation: HMGB2 Antibody (8P10V5) [NBP3-16774] -

Chromatin Immunoprecipitation: HMGB2 Antibody (8P10V5) [NBP3-16774] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using HMGB2 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Applications for HMGB2 Antibody (8P10V5)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5μg antibody for 10μg-15μg of Chromatin.

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HMGB2

HMGB2 encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Alternate Names

High mobility group protein 2, high mobility group protein B2, high-mobility group box 2, HMG-2, HMG2high-mobility group (nonhistone chromosomal) protein 2

Gene Symbol

HMGB2

Additional HMGB2 Products

Product Documents for HMGB2 Antibody (8P10V5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMGB2 Antibody (8P10V5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMGB2 Antibody (8P10V5)

There are currently no reviews for this product. Be the first to review HMGB2 Antibody (8P10V5) and earn rewards!

Have you used HMGB2 Antibody (8P10V5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...