HNF-3 alpha/FoxA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38628

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HNF-3 alpha/FoxA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HNF-3 alpha/FoxA1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunocytochemistry/ Immunofluorescence: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunocytochemistry/Immunofluorescence: HNF-3 alpha/FoxA1 Antibody [NBP2-38628] - Staining of human cell line MCF7 shows localization to nucleoplasm & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628] - Analysis in human prostate and endometrium tissues. Corresponding HNF-3 alpha/FoxA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628]

Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody [NBP2-38628] - Staining of human stomach shows moderate nuclear positivity in glandular cells.
HNF-3 alpha/FoxA1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HNF-3 alpha/FoxA1 Antibody - BSA Free [NBP2-38628]

Chromatin Immunoprecipitation-exo-Seq: HNF-3 alpha/FoxA1 Antibody - BSA Free [NBP2-38628]

ChIP-Exo-Seq composite graph for Anti-FOXA1 (NBP2-38628) tested in HepG2 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HNF-3 alpha/FoxA1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNF-3 alpha/FoxA1

FOXA1 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.

Long Name

Hepatocyte Nuclear Factor-3 alpha/Forkhead Box Protein A1

Alternate Names

FoxA1, HNF3 alpha, TCF3A

Gene Symbol

FOXA1

UniProt

P55317

Additional HNF-3 alpha/FoxA1 Products

Product Documents for HNF-3 alpha/FoxA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HNF-3 alpha/FoxA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNF-3 alpha/FoxA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNF-3 alpha/FoxA1 Antibody - BSA Free and earn rewards!

Have you used HNF-3 alpha/FoxA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies