HNF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38243

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HNF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining in human small intestine and lymph node tissues. Corresponding HNF1A RNA-seq data are presented for the same tissues.
Western Blot: HNF1 Antibody [NBP2-38243]

Western Blot: HNF1 Antibody [NBP2-38243]

Western Blot: HNF1 Antibody [NBP2-38243] - Analysis in human cell lines Caco-2 and U2OS using anti-HNF1A antibody. Corresponding HNF1A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: HNF1 Antibody [NBP2-38243]

Immunocytochemistry/ Immunofluorescence: HNF1 Antibody [NBP2-38243]

Immunocytochemistry/Immunofluorescence: HNF1 Antibody [NBP2-38243] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining of human liver shows weak nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining of human lymph node shows no positivity in lymphoid cells.
Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243]

Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Applications for HNF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNF1

HNF1 is a transcription factor required for the expression of several liver-specific genes. The protein functions as a homodimer and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

HNF1 homeobox A, IDDM20, LFB1transcription factor 1, hepatic; LF-B1, hepatic nuclear factor (HNF1), albuminproximal factor, MODY3, TCF1hepatic, Transcription factor 1

Gene Symbol

HNF1A

UniProt

Additional HNF1 Products

Product Documents for HNF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HNF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNF1 Antibody - BSA Free and earn rewards!

Have you used HNF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...