hnRNP A1 Antibody (10N0F4)

Novus Biologicals | Catalog # NBP3-15405

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10N0F4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human hnRNP A1 (P09651). DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP A1 Antibody (10N0F4)

Western Blot: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Western Blot: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Western Blot: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Analysis of extracts of various cell lines, using hnRNP A1 Rabbit mAb (NBP3-15405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunocytochemistry/Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Immunofluorescence analysis of NIH-3T3 cells using hnRNP A1 Rabbit mAb (NBP3-15405) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunohistochemistry-Paraffin: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunohistochemistry-Paraffin: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Human colon using hnRNP A1 Rabbit mAb (NBP3-15405) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Western Blot: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Western Blot: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Analysis of extracts of various cell lines, using hnRNP A1 Rabbit mAb (NBP3-15405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunocytochemistry/Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Immunofluorescence analysis of C6 cells using hnRNP A1 Rabbit mAb (NBP3-15405) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunocytochemistry/Immunofluorescence: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Immunofluorescence analysis of HeLa cells using hnRNP A1 Rabbit mAb (NBP3-15405) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunoprecipitation: hnRNP A1 Antibody (10N0F4) [NBP3-15405]

Immunoprecipitation: hnRNP A1 Antibody (10N0F4) [NBP3-15405] - Analysis of 300ug extracts of HeLa cells using 3ug hnRNP A1 antibody (NBP3-15405). Western blot was performed from the immunoprecipitate using hnRNP A1 antibody (NBP3-15405) at a dilition of 1:1000.
hnRNP A1 Antibody (10N0F4)

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [hnRNP A1] -

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [hnRNP A1] - Confocal imaging of U-2 OS cells using hnRNP A1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
hnRNP A1 Antibody (10N0F4)

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [hnRNP A1] -

Immunocytochemistry/ Immunofluorescence: hnRNP A1 Antibody (10N0F4) [hnRNP A1] - Confocal imaging of NIH/3T3 cells using hnRNP A1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for hnRNP A1 Antibody (10N0F4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP A1

RNA polymerase II transcripts in the nucleus are in complex with several proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are important in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA translation and turnover. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts.1, 3, 4 Isolated hnRNPs consist of protein groups named A to U and many of these protein groups consist of more than one isoform. The major steady-state proteins of the isolated hnRNP complex are A1, A2, B1, B2, C1, and C2, with a range of molecular weight starting with 34 kDa up to 43 kDa.1, 3, 4 hnRNP-A1 is important in pre-mRNA processing and in mRNA export from the nucleus. The protein binds to its RNA target through a consensus RNA-binding site UAGGGU. The protein contains a 38-amino acid domain called M9, which is important for the interaction with the transportin protein, and therefore, for its import and export from the nucleus. RanGTP mediates dissociation of hnRNP-A1 from transportin. hnRNP-A1 is ubiquitously expressed with a higher expression in proliferating and/or transformed cells than in differentiated tissues.5

Alternate Names

Helix-destabilizing protein, heterogeneous nuclear ribonucleoprotein A1, heterogeneous nuclear ribonucleoprotein A1B protein, heterogeneous nuclear ribonucleoprotein B2 protein, heterogeneous nuclear ribonucleoprotein core protein A1, hnRNP A1, hnRNP core protein A1, hnRNPA1, hnRNP-A1, HNRPA1MGC102835, nuclear ribonucleoprotein particle A1 protein, single-strand DNA-binding protein UP1, Single-strand RNA-binding protein

Gene Symbol

HNRNPA1

Additional hnRNP A1 Products

Product Documents for hnRNP A1 Antibody (10N0F4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP A1 Antibody (10N0F4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP A1 Antibody (10N0F4)

There are currently no reviews for this product. Be the first to review hnRNP A1 Antibody (10N0F4) and earn rewards!

Have you used hnRNP A1 Antibody (10N0F4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...