hnRNP U Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49290

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGG

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 30044993)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP U Antibody - BSA Free

Western Blot: hnRNP U Antibody [NBP2-49290]

Western Blot: hnRNP U Antibody [NBP2-49290]

Western Blot: hnRNP U Antibody [NBP2-49290] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP2-49290]

Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP2-49290]

Immunocytochemistry/Immunofluorescence: hnRNP U Antibody [NBP2-49290] - Staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Applications for hnRNP U Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP U

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Alternate Names

heterogeneous nuclear ribonucleoprotein U, heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A), hnRNP U, HNRPU, p120, p120 nuclear protein, pp120, SAFA, SAF-AhnRNPU, Scaffold attachment factor A, U21.1

Gene Symbol

HNRNPU

Additional hnRNP U Products

Product Documents for hnRNP U Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP U Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for hnRNP U Antibody - BSA Free

Customer Reviews for hnRNP U Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP U Antibody - BSA Free and earn rewards!

Have you used hnRNP U Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...