hnRNP U Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38059

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 608-825 of human hnRNP U (NP_114032.2).

Sequence:
PKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for hnRNP U Antibody - BSA Free

hnRNP U Antibody

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] -

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Rat testis using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
hnRNP U Antibody

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] -

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
hnRNP U Antibody

Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP3-38059] -

Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP3-38059] - Immunofluorescence analysis of C6 cells using hnRNP U Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
hnRNP U Antibody

Western Blot: hnRNP U Antibody [NBP3-38059] -

Western Blot: hnRNP U Antibody [NBP3-38059] - Western blot analysis of various lysates using hnRNP U Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
hnRNP U Antibody

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] -

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
hnRNP U Antibody

Immunoprecipitation: hnRNP U Antibody [NBP3-38059] -

Immunoprecipitation: hnRNP U Antibody [NBP3-38059] - Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug hnRNP U antibody. Western blot was performed from the immunoprecipitate using hnRNP U antibody at a dilution of 1:1000.

Applications for hnRNP U Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP U

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Alternate Names

heterogeneous nuclear ribonucleoprotein U, heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A), hnRNP U, HNRPU, p120, p120 nuclear protein, pp120, SAFA, SAF-AhnRNPU, Scaffold attachment factor A, U21.1

Gene Symbol

HNRNPU

Additional hnRNP U Products

Product Documents for hnRNP U Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP U Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP U Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP U Antibody - BSA Free and earn rewards!

Have you used hnRNP U Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...