HNRNPA0 Antibody

Novus Biologicals | Catalog # NBP1-83240

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse, Rat

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG

Reactivity Notes

Rat, Mouse reactivity reported in scientific literature (PMID: 25257914).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HNRNPA0 Antibody

Western Blot: HNRNPA0 Antibody [NBP1-83240]

Western Blot: HNRNPA0 Antibody [NBP1-83240]

Western Blot: HNRNPA0 Antibody [NBP1-83240] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HNRNPA0 Antibody [NBP1-83240]

Immunocytochemistry/ Immunofluorescence: HNRNPA0 Antibody [NBP1-83240]

Immunocytochemistry/Immunofluorescence: HNRNPA0 Antibody [NBP1-83240] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
HNRNPA0 Antibody Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Staining of human liver shows no nuclear positivity in hepatocytes as expected.
HNRNPA0 Antibody Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Staining of human cerebral cortex shows strong nuclear positivity in neurons.
HNRNPA0 Antibody Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Staining of human colon shows moderate nuclear positivity in glandular cells.
HNRNPA0 Antibody Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Staining of human endometrium shows moderate nuclear positivity in glandular cells.
HNRNPA0 Antibody Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240]

Staining of human cerebral cortex, endometrium, liver and lower gastrointestinal HPA036569 (A) shows similar protein distribution across tissues to independent antibody HPA059404 (B).

Applications for HNRNPA0 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNRNPA0

HNRNPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq]

Alternate Names

heterogeneous nuclear ribonucleoprotein A0, hnRNA binding protein, hnRNPA0, HNRPA0hnRNP A0

Gene Symbol

HNRNPA0

Additional HNRNPA0 Products

Product Documents for HNRNPA0 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HNRNPA0 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HNRNPA0 Antibody

Customer Reviews for HNRNPA0 Antibody

There are currently no reviews for this product. Be the first to review HNRNPA0 Antibody and earn rewards!

Have you used HNRNPA0 Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...