HNRNPUL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47432

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HNRNPUL1 Antibody - BSA Free

Western Blot: HNRNPUL1 Antibody [NBP2-47432]

Western Blot: HNRNPUL1 Antibody [NBP2-47432]

Western Blot: HNRNPUL1 Antibody [NBP2-47432] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: HNRNPUL1 Antibody [NBP2-47432]

Immunocytochemistry/ Immunofluorescence: HNRNPUL1 Antibody [NBP2-47432]

Immunocytochemistry/Immunofluorescence: HNRNPUL1 Antibody [NBP2-47432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human testis.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human colon, kidney, liver and testis using Anti-HNRNPUL1 antibody NBP2-47432 (A) shows similar protein distribution across tissues to independent antibody NBP2-47431 (B).
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human liver.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human kidney.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432]

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human colon.

Applications for HNRNPUL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNRNPUL1

HNRNPUL1 encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Two transcript variants encoding different isoforms have been found for this gene. Additional variants have also been found, but their full-length natures have not been determined. [provided by RefSeq]

Alternate Names

Adenovirus early region 1B-associated protein 5, E1B-AP5E1B 55kDa associated protein 5, E1BAP5E1B-55 kDa-associated protein 5, FLJ12944, heterogeneous nuclear ribonucleoprotein U-like 1, heterogeneous nuclear ribonucleoprotein U-like protein 1, HNRPUL1E1B-55kDa-associated protein 5

Gene Symbol

HNRNPUL1

Additional HNRNPUL1 Products

Product Documents for HNRNPUL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HNRNPUL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNRNPUL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNRNPUL1 Antibody - BSA Free and earn rewards!

Have you used HNRNPUL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...