HO-1/HMOX1/HSP32 Antibody (7H7W10)

Novus Biologicals | Catalog # NBP3-15640

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7H7W10 expressed in HEK293
View all HO-1/HMOX1/HSP32 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1). MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HO-1/HMOX1/HSP32 Antibody (7H7W10)

HO-1/HMOX1/HSP32 Antibody (3L2U4) HO-1/HMOX1/HSP32 Antibody (3L2U4)

analysis of extracts of Raw264.7 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A19062) at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.

analysis of extracts of Raw264.7 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A19062) at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.
HO-1/HMOX1/HSP32 Antibody (3L2U4) HO-1/HMOX1/HSP32 Antibody (3L2U4)

HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] - Analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] - Analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
HO-1/HMOX1/HSP32 Antibody (3L2U4) HO-1/HMOX1/HSP32 Antibody (3L2U4)

Western Blot: Rabbit HO-1/HMOX1/HSP32 mAb (7H7W10) [NBP3-15640] -

Western Blot: Rabbit HO-1/HMOX1/HSP32 mAb (7H7W10) [NBP3-15640] - Analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
HO-1/HMOX1/HSP32 Antibody (7H7W10)

Immunohistochemistry: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] -

Immunohistochemistry: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] HO-1/HMOX1/HSP32 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HO-1/HMOX1/HSP32 Antibody (7H7W10)

Immunohistochemistry: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] -

Immunohistochemistry: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KD Validated] HO-1/HMOX1/HSP32 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HO-1/HMOX1/HSP32 Antibody (7H7W10)

Immunohistochemistry: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] -

Immunohistochemistry: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] HO-1/HMOX1/HSP32 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HO-1/HMOX1/HSP32 Antibody (7H7W10)

Immunocytochemistry/ Immunofluorescence: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] -

Immunocytochemistry/ Immunofluorescence: HO-1/HMOX1/HSP32 Antibody (7H7W10) [NBP3-15640] - Immunofluorescence analysis of paraffin-embedded human spleen using [KD Validated] HO-1/HMOX1/HSP32 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for HO-1/HMOX1/HSP32 Antibody (7H7W10)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:200 - 1:800

Immunohistochemistry-Paraffin

1:200 - 1:800

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HO-1/HMOX1/HSP32

Stressed mammalian cells up-regulate heme oxygenase 1 (HO-1), which catabolizes heme to biliverdin, carbon monoxide, and free iron. Results provide genetic evidence that up-regulation of HO-1 serves as an adaptive mechanism to protect cells from oxidative damage during stress (1). When cells are injured they release their contents, resulting in a local accumulation of free heme proteins and heme. HO-1 plays a crucial role in the inflammatory process during wound healing (2). TNFalpha accelerates inflammatory responses by down-regulating HO-1 expression in human monocytes. TNF antagonists may block this TNF-dependent suppression of HO-1 expression, resulting in an amelioration of inflammation (3).

Long Name

Heme Oxygenase 1

Alternate Names

HMOX1, HO1, HSP32

Gene Symbol

HMOX1

Additional HO-1/HMOX1/HSP32 Products

Product Documents for HO-1/HMOX1/HSP32 Antibody (7H7W10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HO-1/HMOX1/HSP32 Antibody (7H7W10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HO-1/HMOX1/HSP32 Antibody (7H7W10)

There are currently no reviews for this product. Be the first to review HO-1/HMOX1/HSP32 Antibody (7H7W10) and earn rewards!

Have you used HO-1/HMOX1/HSP32 Antibody (7H7W10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies