HOXC5 Antibody (1E10) - Azide and BSA Free

Novus Biologicals | Catalog # H00003222-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human

Applications

Validated:

Immunohistochemistry, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E10

Format

Azide and BSA Free
View all HOXC5 Primary Antibodies »

Product Specifications

Immunogen

HOXC5 (NP_061826.1, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR

Specificity

HOXC5 - homeobox C5 (1E10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HOXC5 Antibody (1E10) - Azide and BSA Free

Sandwich ELISA: HOXC5 Antibody (1E10) [H00003222-M01] - Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.

Applications for HOXC5 Antibody (1E10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOXC5

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq]

Alternate Names

homeo box C5, homeobox C5, Homeobox protein CP11, Homeobox protein Hox-3D, homeobox protein Hox-C5, HOX3, HOX3DCP11

Entrez Gene IDs

3222 (Human)

Gene Symbol

HOXC5

UniProt

NP_061826 (Human)

Additional HOXC5 Products

Product Documents for HOXC5 Antibody (1E10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOXC5 Antibody (1E10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HOXC5 Antibody (1E10) - Azide and BSA Free

Customer Reviews for HOXC5 Antibody (1E10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXC5 Antibody (1E10) - Azide and BSA Free and earn rewards!

Have you used HOXC5 Antibody (1E10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies