HSP60 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89730

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL

Marker

Mitochondria Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSP60 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HSP60 Antibody [NBP1-89730]

Immunocytochemistry/ Immunofluorescence: HSP60 Antibody [NBP1-89730]

Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-89730] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HSP60 Antibody [NBP1-89730]

Immunohistochemistry-Paraffin: HSP60 Antibody [NBP1-89730]

Immunohistochemistry-Paraffin: HSP60 Antibody [NBP1-89730] - Staining of human kidney shows strong cytoplasmic positivity in cells of renal tubules.
HSP60 Antibody - BSA Free Western Blot: HSP60 Antibody - BSA Free [NBP1-89730]

Western Blot: HSP60 Antibody - BSA Free [NBP1-89730]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: HSP60 Antibody [NBP1-89730]

Western Blot: HSP60 Antibody [NBP1-89730]

Western Blot: HSP60 Antibody [NBP1-89730] - Analysis using Anti-HSPD1 antibody NBP1-89730 (A) shows similar pattern to independent antibody NBP2-55503 (B).
HSP60 Antibody - BSA Free Western Blot: HSP60 Antibody - BSA Free [NBP1-89730]

Western Blot: HSP60 Antibody - BSA Free [NBP1-89730]

Analysis in human cell line HepG2.

Applications for HSP60 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSP60

Hsp60 is a member of a highly conserved family which includes molecular chaperones from several species such as plant Hsp60 (known as Rubisco binding protein), GroEL, the E.coli Hsp60 and 65 kDa major antigen of mycobacteria. In eukaryotes, Hsp60 is localized in the mitochondrial matrix and in plants Hsp60 is localized in the chloroplast. Mitochondria, chloroplasts and bacteria have a common ancestry (>1 billion years) and this fact together with the high degree of homology between the divergent Hsp60s would indicate that these proteins carry out a primitive but important function which is similar to all of these different species. The common characteristics of the Hsp60s from the divergent species are i) high abundance, ii) induction with environmental stress such as heat shock, iii) homo oligomeric structures of either 7 or 14 subunits which reversibly dissociate in the presence of magnesium ions and ATP, iv) ATPase activity and v) a role in folding and assembly of oligomeric protein structures. These similarities are supported by recent studies where the single ring human mitochondrial homolog, Hsp60 with its co chaperonin, Hsp10 were expressed in a E. coli strain, engineered so that the groE operon is under strict regulatory control. This study has demonstrated that expression of Hsp60-Hsp10 was able to carry out all essential in vivo functions of GroEL and its co chaperonin, GroES. Consistent with their functions as chaperones, Hsp60 and Hsp10 have been suggested to act as docking molecules with a passive role in the maturation of caspase processing. Data demonstrates that recombinant Hsp60 and Hsp10 have been shown to accelerate the activation of procaspase 3 by cytochrome c and dATP in an ATP dependent manner. Hsps are intracellular proteins which are thought to serve protective functions against infection and cellular stress, however several recent studies indicate that members of the Hsp60 family are linked to a number of autoimmune diseases, arthrosclerosis and chlamydial disease.

Long Name

Heat Shock Protein 60

Alternate Names

cpn60, GROEL, HSPD1, SPG13

Gene Symbol

HSPD1

Additional HSP60 Products

Product Documents for HSP60 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSP60 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for HSP60 Antibody - BSA Free

Customer Reviews for HSP60 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSP60 Antibody - BSA Free and earn rewards!

Have you used HSP60 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...