HSPC111 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89659

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSPC111 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [NBP1-89659]

Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [NBP1-89659]

Immunocytochemistry/Immunofluorescence: HSPC111 Antibody [NBP1-89659] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & vesicles. Antibody staining is shown in green.
HSPC111 Antibody - BSA Free Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.
HSPC111 Antibody - BSA Free Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Staining of human cerebral cortex shows strong positivity in nucleoli in neurons.
HSPC111 Antibody - BSA Free Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Staining of human colon shows strong positivity in nucleoli in glandular cells.
HSPC111 Antibody - BSA Free Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Immunohistochemistry-Paraffin: HSPC111 Antibody - BSA Free [NBP1-89659]

Staining of human kidney shows strong positivity in nucleoli in cells in tubules.
HSPC111 Antibody - BSA Free Western Blot: HSPC111 Antibody - BSA Free [NBP1-89659]

Western Blot: HSPC111 Antibody - BSA Free [NBP1-89659]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: HSPC111 Antibody [NBP1-89659]

Western Blot: HSPC111 Antibody [NBP1-89659]

Western Blot: HSPC111 Antibody [NBP1-89659] - Analysis using Anti-NOP16 antibody NBP1-89659 (A) shows similar pattern to independent antibody NBP2-58774 (B).

Applications for HSPC111 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSPC111

NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).(supplied by OMIM)

Alternate Names

HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast)

Gene Symbol

NOP16

Additional HSPC111 Products

Product Documents for HSPC111 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSPC111 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSPC111 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSPC111 Antibody - BSA Free and earn rewards!

Have you used HSPC111 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...