Human Neuropeptide Y/NPY Alexa Fluor® 405-conjugated Antibody

Catalog # Availability Size / Price Qty
FAB8517V-100UG

Save 15% on Select RUO Reagents. See Details

Product Details
FAQs
Supplemental Products
Reviews

Human Neuropeptide Y/NPY Alexa Fluor® 405-conjugated Antibody Summary

Species Reactivity
Human
Specificity
Detects human Neuropeptide Y/NPY in direct ELISAs.
Source
Monoclonal Mouse IgG2a Clone # 904032
Purification
Protein A or G purified
Immunogen
Neuropeptide Y/NPY conjugated to KLH
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
Formulation
Supplied 0.2mg/ml in 1X PBS with RDF1 and 0.09% Sodium Azide
Label
Alexa Fluor 405 (Excitation= 405 nm, Emission= 421 nm)

Applications

Recommended Concentration
Sample
Immunohistochemistry
Optimal dilution of this antibody should be experimentally determined.
 

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 °C as supplied

Background: Neuropeptide Y/NPY

Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with  G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are  rhodopsin-like G-protein coupled receptors (GPCR) coupled to Gi or G0 proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.      

Entrez Gene IDs
4852 (Human); 109648 (Mouse); 24604 (Rat); 397304 (Porcine)
Alternate Names
170 kDa melanoma membrane-bound gelatinase; DKFZp686G13158; DPPIV; EC 3.4.21.-; FAPA; Fibroblast activation protein alpha; fibroblast activation protein, alpha; Integral membrane serine protease; Neuropeptide Y; NPY; PYY4; seprase

Product Datasheets

You must select a language.

x

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs
Loading...

Reviews for Human Neuropeptide Y/NPY Alexa Fluor® 405-conjugated Antibody

There are currently no reviews for this product. Be the first to review Human Neuropeptide Y/NPY Alexa Fluor® 405-conjugated Antibody and earn rewards!

Have you used Human Neuropeptide Y/NPY Alexa Fluor® 405-conjugated Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review