Human Neuropeptide Y/NPY Antibody

Catalog # Availability Size / Price Qty
MAB8517
MAB8517-SP
Neuropeptide Y/NPY in Human Brain.
2 Images
Product Details
Citations (1)
FAQs
Supplemental Products
Reviews

Human Neuropeptide Y/NPY Antibody Summary

Species Reactivity
Human
Specificity
Detects human Neuropeptide Y/NPY in direct ELISAs.
Source
Monoclonal Mouse IgG2A Clone # 904032
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Neuropeptide Y/NPY conjugated to KLH
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
Label
Unconjugated

Applications

Recommended Concentration
Sample
Immunohistochemistry
8-25 µg/mL
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Immunohistochemistry Neuropeptide Y/NPY antibody in Human Brain by Immunohistochemistry (IHC-P). View Larger

Neuropeptide Y/NPY in Human Brain. Neuropeptide Y/NPY was detected in immersion fixed paraffin-embedded sections of human brain (hypothalamus) using Mouse Anti-Human Neuropeptide Y/NPY Monoclonal Antibody (Catalog # MAB8517) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Western Blot Detection of Mouse Neuropeptide Y/NPY by Western Blot View Larger

Detection of Mouse Neuropeptide Y/NPY by Western Blot ICAM-1 reduces neurotransmitters expression that reflects in sensorimotor deficits and psychological stress after TBI. A, Immunofluorescent staining of NE (red) in the hippocampus area of WT and ICAM-1−/− mice after 10 and 20 psi FPI and merged with NeuN (green) and DAPI (blue). Scale bar: 20 μm (all panels). B, Quantification of NE staining in the hippocampus area of uninjured, 10 and 20 psi FPI WT and ICAM-1−/− mice using ImageJ software (n = 6/group). C–E, Western blot analysis of 5-HT1AR (C), DAD1R (D), NPY (E) and beta -actin in the tissue lysates of hippocampus of WT and ICAM-1−/− mice 48 h after 10 and 20 psi FPI. The bar graph with dot plots shows the quantification of 5-HT1AR (C), DAD1R (D), NPY (E) versus beta -actin (n = 6/group). F, Schematic presentation of the findings. All values are expressed as mean ± SD two-way ANOVA followed by Bonferroni post hoc tests. Statistically significant ***p < 0.001 versus WT uninjured group; @@@p < 0.001 versus uninjured ICAM-1−/− group; #p < 0.05, ##p < 0.01, ###p < 0.001 versus WT corresponding injury groups; ns = non-significant. NE, norepinephrine; 5-HT1AR, 5-HT 1A receptor; DAD1R, DA D1 receptor; NPY, neuropeptide Y. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34135004), licensed under a CC-BY license. Not internally tested by R&D Systems.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Reconstitution
Reconstitute at 0.5 mg/mL in sterile PBS.
Loading...
Shipping
Lyophilized product is shipped at ambient temperature. Liquid small pack size (-SP) is shipped with polar packs. Upon receipt, store immediately at the temperature recommended below.
Stability & Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: Neuropeptide Y/NPY

Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with  G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are  rhodopsin-like G-protein coupled receptors (GPCR) coupled to Gi or G0 proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.      

Entrez Gene IDs
4852 (Human); 109648 (Mouse); 24604 (Rat); 397304 (Porcine)
Alternate Names
170 kDa melanoma membrane-bound gelatinase; DKFZp686G13158; DPPIV; EC 3.4.21.-; FAPA; Fibroblast activation protein alpha; fibroblast activation protein, alpha; Integral membrane serine protease; Neuropeptide Y; NPY; PYY4; seprase

Product Datasheets

You must select a language.

x

Citation for Human Neuropeptide Y/NPY Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs
Loading...

Reviews for Human Neuropeptide Y/NPY Antibody

There are currently no reviews for this product. Be the first to review Human Neuropeptide Y/NPY Antibody and earn rewards!

Have you used Human Neuropeptide Y/NPY Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review