Human Neuropeptide Y/NPY Alexa Fluor® 488-conjugated Antibody Summary
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
Applications
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Reconstitution Calculator
Preparation and Storage
Background: Neuropeptide Y/NPY
Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are rhodopsin-like G-protein coupled receptors (GPCR) coupled to Gi or G0 proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.
Product Datasheets
FAQs
No product specific FAQs exist for this product, however you may
View all Antibody FAQsReviews for Human Neuropeptide Y/NPY Alexa Fluor® 488-conjugated Antibody
There are currently no reviews for this product. Be the first to review Human Neuropeptide Y/NPY Alexa Fluor® 488-conjugated Antibody and earn rewards!
Have you used Human Neuropeptide Y/NPY Alexa Fluor® 488-conjugated Antibody?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
