IDH3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85840

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IDH3A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IDH3A Antibody [NBP1-85840]

Immunocytochemistry/ Immunofluorescence: IDH3A Antibody [NBP1-85840]

Immunocytochemistry/Immunofluorescence: IDH3A Antibody [NBP1-85840] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
IDH3A Antibody - BSA Free Western Blot: IDH3A Antibody - BSA Free [NBP1-85840]

Western Blot: IDH3A Antibody - BSA Free [NBP1-85840]

Analysis in human cell line U-251 MG.
IDH3A Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Analysis in human heart muscle and liver tissues. Corresponding RNA-seq data are presented for the same tissues.
IDH3A Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.
IDH3A Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells.
IDH3A Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Staining of human Liver shows very weak granular cytoplasmic positivity in hepatocytes.
IDH3A Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840]

Staining of human Heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.

Applications for IDH3A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IDH3A

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. [provided by RefSeq]

Alternate Names

EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alpha, NAD(H)-specific isocitrate dehydrogenase alpha subunit, NAD+-specific ICDH

Gene Symbol

IDH3A

Additional IDH3A Products

Product Documents for IDH3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IDH3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IDH3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IDH3A Antibody - BSA Free and earn rewards!

Have you used IDH3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...