IDH3G Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85824

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVI

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IDH3G Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IDH3G Antibody [NBP1-85824]

Immunocytochemistry/ Immunofluorescence: IDH3G Antibody [NBP1-85824]

Immunocytochemistry/Immunofluorescence: IDH3G Antibody [NBP1-85824] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
IDH3G Antibody - BSA Free Western Blot: IDH3G Antibody - BSA Free [NBP1-85824]

Western Blot: IDH3G Antibody - BSA Free [NBP1-85824]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)
IDH3G Antibody - BSA Free Western Blot: IDH3G Antibody - BSA Free [NBP1-85824]

Western Blot: IDH3G Antibody - BSA Free [NBP1-85824]

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431
IDH3G Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Analysis in human cerebral cortex and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.
IDH3G Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Staining of human pancreas shows weak positivity in exocrine glandular cells.
IDH3G Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.
IDH3G Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
IDH3G Antibody - BSA Free Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824]

Staining of human fallopian tube shows weak to moderate granular cytoplasmic positivity in glandular cells.

Applications for IDH3G Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IDH3G

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. [provided by RefSeq]

Alternate Names

EC 1.1.1, EC 1.1.1.41, H-IDHG, IDH-gamma, isocitrate dehydrogenase 3 (NAD+) gamma, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit, mitochondrial, NAD (H)-specific isocitrate dehydrogenase gamma subunit, NAD+-specific ICDH

Gene Symbol

IDH3G

Additional IDH3G Products

Product Documents for IDH3G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IDH3G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IDH3G Antibody - BSA Free

Customer Reviews for IDH3G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IDH3G Antibody - BSA Free and earn rewards!

Have you used IDH3G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...