Ikaros/IKZF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38241

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ikaros/IKZF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunocytochemistry/ Immunofluorescence: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunocytochemistry/Immunofluorescence: Ikaros/IKZF1 Antibody [NBP2-38241] - Staining of human cell line REH shows localization to nucleoplasm. Antibody staining is shown in green.
Ikaros/IKZF1 Antibody - BSA Free Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Analysis in human tonsil and cerebral cortex tissues. Corresponding RNA-seq data are presented for the same tissues.
Ikaros/IKZF1 Antibody - BSA Free Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Ikaros/IKZF1 Antibody - BSA Free Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Ikaros/IKZF1 Antibody - BSA Free Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Staining of human kidney shows no positivity in cells in tubules as expected.
Ikaros/IKZF1 Antibody - BSA Free Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Staining of human cerebral cortex shows no positivity in neurons as expected.
Ikaros/IKZF1 Antibody - BSA Free Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Immunohistochemistry-Paraffin: Ikaros/IKZF1 Antibody [NBP2-38241]

Staining of human cerebral cortex, kidney, testis and tonsil HPA035221 (A) shows similar protein distribution across tissues to independent antibody HPA035222 (B).

Applications for Ikaros/IKZF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ikaros

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs)

Long Name

DNA-binding protein Ikaros

Alternate Names

IK1, IKZF1, LyF-1, LYF1, PRO0758, ZNFN1A1

Gene Symbol

IKZF1

UniProt

Additional Ikaros Products

Product Documents for Ikaros/IKZF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ikaros/IKZF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ikaros/IKZF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ikaros/IKZF1 Antibody - BSA Free and earn rewards!

Have you used Ikaros/IKZF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies