IkB-beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57108

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL

Reactivity Notes

Mouse 89%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IkB-beta Antibody - BSA Free

Western Blot: IkB-beta Antibody [NBP2-57108]

Western Blot: IkB-beta Antibody [NBP2-57108]

Western Blot: IkB-beta Antibody [NBP2-57108] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: IkB-beta Antibody [NBP2-57108]

Immunocytochemistry/ Immunofluorescence: IkB-beta Antibody [NBP2-57108]

Immunocytochemistry/Immunofluorescence: IkB-beta Antibody [NBP2-57108] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol.

Applications for IkB-beta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IkB-beta

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]

Long Name

I-kappa-B-beta

Alternate Names

IkBbeta, NFKBIB, TR-interacting protein 9

Gene Symbol

NFKBIB

Additional IkB-beta Products

Product Documents for IkB-beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IkB-beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IkB-beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IkB-beta Antibody - BSA Free and earn rewards!

Have you used IkB-beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies