ITCH/AIP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55083

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS

Reactivity Notes

Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ITCH/AIP4 Antibody - BSA Free

Western Blot: ITCH/AIP4 Antibody [NBP2-55083]

Western Blot: ITCH/AIP4 Antibody [NBP2-55083]

Western Blot: ITCH/AIP4 Antibody [NBP2-55083] - Analysis in human cell lines Caco-2 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: ITCH/AIP4 Antibody [NBP2-55083]

Immunocytochemistry/ Immunofluorescence: ITCH/AIP4 Antibody [NBP2-55083]

Immunocytochemistry/Immunofluorescence: ITCH/AIP4 Antibody [NBP2-55083] - Staining of human cell line A-431 shows localization to nucleoplasm.
Western Blot: ITCH/AIP4 Antibody [NBP2-55083]

Western Blot: ITCH/AIP4 Antibody [NBP2-55083]

Western Blot: ITCH/AIP4 Antibody [NBP2-55083] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Applications for ITCH/AIP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ITCH/AIP4

Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells.

Long Name

Itchy E3 Ubiquitin Protein Ligase

Alternate Names

AIF4, AIP4, NAPP1

Gene Symbol

ITCH

Additional ITCH/AIP4 Products

Product Documents for ITCH/AIP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ITCH/AIP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for ITCH/AIP4 Antibody - BSA Free

Customer Reviews for ITCH/AIP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ITCH/AIP4 Antibody - BSA Free and earn rewards!

Have you used ITCH/AIP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies