Kinesin 5B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58450

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETVPIDEQFDKEKANLEAFTVDKDITLTNDKPATAIGVIGNFTDAERRKCEEEIAKLYKQLD

Reactivity Notes

Mouse 84%, Rat 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kinesin 5B Antibody - BSA Free

Western Blot: Kinesin 5B Antibody [NBP2-58450]

Western Blot: Kinesin 5B Antibody [NBP2-58450]

Western Blot: Kinesin 5B Antibody [NBP2-58450] - Analysis using Anti-KIF5B antibody NBP2-58450 (A) shows similar pattern to independent antibody NBP2-58451 (B).
Immunocytochemistry/ Immunofluorescence: Kinesin 5B Antibody [NBP2-58450]

Immunocytochemistry/ Immunofluorescence: Kinesin 5B Antibody [NBP2-58450]

Immunocytochemistry/Immunofluorescence: Kinesin 5B Antibody [NBP2-58450] - Staining of human cell line U-2 OS shows localization to cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: Kinesin 5B Antibody [NBP2-58450]

Immunohistochemistry-Paraffin: Kinesin 5B Antibody [NBP2-58450]

Immunohistochemistry-Paraffin: Kinesin 5B Antibody [NBP2-58450] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Applications for Kinesin 5B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kinesin 5B

KIF5B is a kinesin. These are microtubule based motor proteins involved in the transport of organelles in eukaryotic cells. They typically consist of 2 identical, approximately 110 to 120 kD heavy chains and 2 identical, approximately 60 to 70 kD light chains. The heavy chain contains 3 domains: a globular N terminal motor domain, which converts the chemical energy of ATP into a motile force along microtubules in 1 fixed direction; a central alpha helical rod domain, which enables the 2 heavy chains to dimerize; and a globular C terminal domain, which interacts with light chains and possibly an organelle receptor.

Alternate Names

Conventional kinesin heavy chain, kinesin family member 5B, kinesin-1 heavy chain, KNS1kinesin 1 (110-120kD), KNSKINH, Ubiquitous kinesin heavy chain, UKHCkinesin heavy chain

Gene Symbol

KIF5B

Additional Kinesin 5B Products

Product Documents for Kinesin 5B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kinesin 5B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kinesin 5B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kinesin 5B Antibody - BSA Free and earn rewards!

Have you used Kinesin 5B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...