KPNA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38526

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human KPNA3 (NP_002258.2).

Sequence:
MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KPNA3 Antibody - BSA Free

KPNA3 Antibody

Immunohistochemistry: KPNA3 Antibody [NBP3-38526] -

Immunohistochemistry: KPNA3 Antibody [NBP3-38526] - Immunohistochemistry analysis of paraffin-embedded Mouse pancreas using KPNA3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
KPNA3 Antibody

Immunohistochemistry: KPNA3 Antibody [NBP3-38526] -

Immunohistochemistry: KPNA3 Antibody [NBP3-38526] - Immunohistochemistry analysis of paraffin-embedded Rat stomach using KPNA3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
KPNA3 Antibody

Immunocytochemistry/ Immunofluorescence: KPNA3 Antibody [NBP3-38526] -

Immunocytochemistry/ Immunofluorescence: KPNA3 Antibody [NBP3-38526] - Immunofluorescence analysis of L929 cells using KPNA3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
KPNA3 Antibody

Immunocytochemistry/ Immunofluorescence: KPNA3 Antibody [NBP3-38526] -

Immunocytochemistry/ Immunofluorescence: KPNA3 Antibody [NBP3-38526] - Immunofluorescence analysis of H9C2 cells using KPNA3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
KPNA3 Antibody

Western Blot: KPNA3 Antibody [NBP3-38526] -

Western Blot: KPNA3 Antibody [NBP3-38526] - Western blot analysis of various lysates using KPNA3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
KPNA3 Antibody

Immunohistochemistry: KPNA3 Antibody [NBP3-38526] -

Immunohistochemistry: KPNA3 Antibody [NBP3-38526] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using KPNA3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
KPNA3 Antibody

Immunocytochemistry/ Immunofluorescence: KPNA3 Antibody [NBP3-38526] -

Immunocytochemistry/ Immunofluorescence: KPNA3 Antibody [NBP3-38526] - Immunofluorescence analysis of U2OS cells using KPNA3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for KPNA3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KPNA3

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. [provided by RefSeq]

Alternate Names

hSRP1, importin alpha 4, Importin alpha Q2, importin alpha-3, importin subunit alpha-3, importin-alpha-Q2, IPOA4, karyopherin alpha 3 (importin alpha 4), Karyopherin subunit alpha-3, QIP2, SRP1, SRP1gamma, SRP1-gamma, SRP4

Gene Symbol

KPNA3

Additional KPNA3 Products

Product Documents for KPNA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KPNA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KPNA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KPNA3 Antibody - BSA Free and earn rewards!

Have you used KPNA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...