Lamin B1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-03711
![Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]](https://resources.rndsystems.com/images/products/Lamin-B1-Antibody-Western-Blot-NBP3-03711-img0010.jpg "Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]")
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1). RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Lamin B1 Antibody - BSA Free
Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]
Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 hour. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.Exposure time: 30s.![Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]](https://resources.rndsystems.com/images/products/Lamin-B1-Antibody-Western-Blot-NBP3-03711-img0009.jpg "Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]")
Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]
Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37c for 5 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.![Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [NBP3-03711]](https://resources.rndsystems.com/images/products/Lamin-B1-Antibody-Immunoprecipitation-NBP3-03711-img0011.jpg "Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [NBP3-03711]")
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [NBP3-03711]
Immunoprecipitation: Lamin B1 Antibody [NBP3-03711] - Analysis of 300ug extracts of MCF7 cells using 3ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilition of 1:1000.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of U2OS cells using Lamin B1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunoprecipitation of Lamin B1 in 300 ug extracts from Jurkat cells using 0.5 ug Lamin B1 Rabbit pAb. Western blot analysis was performed using Lamin B1 Rabbit pAb at 1:1000 dilution.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of C6 cells using Lamin B1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Chromatin immunoprecipitation was performed with cross-linked chromatin from HeLa, using Lamin-B1 Rabbit mAb and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram compares the ratio of the immunoprecipitated DNA versus the input.
Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Lamin B1 Rabbit pAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of PC-12 cells using Lamin B1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilution of 1:1000.
Western Blot: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Western Blot: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Western blot analysis of various lysates using Lamin B1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1min.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of NIH/3T3 cells using Lamin B1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for Lamin B1 Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
5μg antibody for 10μg-15μg of Chromatin
ELISA
Recommended starting concentration is 1 μg/mL
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Lamin B1
Alternate Names
ADLD, LMN2, LMNB1
Gene Symbol
LMNB1
Additional Lamin B1 Products
Product Documents for Lamin B1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Lamin B1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govRelated Research Areas
Customer Reviews for Lamin B1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Lamin B1 Antibody - BSA Free and earn rewards!
Have you used Lamin B1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Lamin B1 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
A:
We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.
Loading...