LEDGF Antibody (1C4) - Azide and BSA Free

Novus Biologicals | Catalog # H00011168-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1C4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET

Specificity

PSIP1 - PC4 and SFRS1 interacting protein 1 (1C4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for LEDGF Antibody (1C4) - Azide and BSA Free

Western Blot: LEDGF Antibody (1C4) [H00011168-M02]

Western Blot: LEDGF Antibody (1C4) [H00011168-M02]

Western Blot: LEDGF Antibody (1C4) [H00011168-M02] - PSIP1 monoclonal antibody (M02), clone 1C4. Analysis of PSIP1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: LEDGF Antibody (1C4) [H00011168-M02]

Immunocytochemistry/ Immunofluorescence: LEDGF Antibody (1C4) [H00011168-M02]

Immunocytochemistry/Immunofluorescence: LEDGF Antibody (1C4) [H00011168-M02] - Analysis of monoclonal antibody to PSIP1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: LEDGF Antibody (1C4) [H00011168-M02]

Western Blot: LEDGF Antibody (1C4) [H00011168-M02]

Western Blot: LEDGF Antibody (1C4) [H00011168-M02] - PSIP1 monoclonal antibody (M02), clone 1C4. Analysis of PSIP1 expression in human kidney.

Applications for LEDGF Antibody (1C4) - Azide and BSA Free

Application
Recommended Usage

ELISA

1:100-1:2000

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: LEDGF

The human p75 protein is a non TAF transcription coactivator that mediates activator dependent transcription by RNA polymerase II in vitro through most tested activators. Although p75 and p52 are derived from alternatively splicing of a single gene and share most coding sequence, they reveal different function in several aspects. In addition to functioning as a transcription coactivator, p75 has been reported to be involved in regulating growth of epithelial cells, pathogenesis of atopic dermatitis and activity of HIV1 integrase.

Long Name

Lens Epithelium-derived Growth Factor

Alternate Names

CLL-associated antigen KW-7, DFS 70, PSIP1, Transcriptional coactivator p75/p52

Entrez Gene IDs

11168 (Human)

Gene Symbol

PSIP1

Additional LEDGF Products

Product Documents for LEDGF Antibody (1C4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LEDGF Antibody (1C4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LEDGF Antibody (1C4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review LEDGF Antibody (1C4) - Azide and BSA Free and earn rewards!

Have you used LEDGF Antibody (1C4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...