Leptin/OB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59324

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Leptin/OB Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected from the middle region of LEP (NP_000221). Peptide sequence LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Reactivity to mouse reported in scientific literature (PMID: 31638172). Reactivity to rat reported in scientific literature.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Leptin/OB Antibody - BSA Free

Western Blot: Leptin/OB Antibody [NBP1-59324]

Western Blot: Leptin/OB Antibody [NBP1-59324]

Western Blot: Leptin/OB Antibody [NBP1-59324] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: Leptin/OB Antibody [NBP1-59324]

Immunohistochemistry-Paraffin: Leptin/OB Antibody [NBP1-59324]

Immunohistochemistry-Paraffin: Leptin/OB Antibody [NBP1-59324] - Human pancreas tissue, 4-8ug/ml.
Simple Western: Leptin/OB Antibody [NBP1-59324]

Simple Western: Leptin/OB Antibody [NBP1-59324]

Simple Western: Leptin/OB Antibody [NBP1-59324] - Simple Western analysis of Leptin. Lane 1- biotinylated ladder; Lane 2- negative control (non-transfected MIN6 cells, 0.2 mg/ml); Lane 3- MIN6 cells transfected with plasmid expressing mouse leptin (positive control, 0.2 mg/ml). Image from verified customer review.

Applications for Leptin/OB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

4-8 ug/ml

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml
Application Notes

See Simple Western Antibody Database for Simple Western validation: Tested in MIN6 cells, non-transfected and transfected with plasmid expressing mouse leptin, both at 0.2 mg/mL, separated by Size

Reviewed Applications

Read 1 review rated 5 using NBP1-59324 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Leptin/OB

LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

LEP, OB

Entrez Gene IDs

3952 (Human)

Gene Symbol

LEP

UniProt

P41159

Additional Leptin/OB Products

Product Documents for Leptin/OB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Leptin/OB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Leptin/OB Antibody - BSA Free

Customer Reviews for Leptin/OB Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Leptin/OB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Leptin/OB Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: MIN6 cells transfected with plasmid expressing mouse leptin
    Species: Mouse
    Verified Customer | Posted 10/28/2016
    Simple Western analysis of Leptin. Lane 1- biotinylated ladder; Lane 2- negative control (non-transfected MIN6 cells, 0.2 mg/ml); Lane 3- MIN6 cells transfected with plasmid expressing mouse leptin (positive control, 0.2 mg/ml).
    Leptin/OB Antibody - BSA Free NBP1-59324

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies