LONP1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81734
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse, Insect - Drosophila
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated
Cited:
Western Blot, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Reactivity Notes
Drosophila reactivity reported in scientific literature (PMID: 29467464).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LONP1 Antibody - BSA Free
Simple Western: LONP1 Antibody [NBP1-81734]
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left), NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734]
Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.Western Blot: LONP1 Antibody [NBP1-81734]
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.Simple Western: LONP1 Antibody [NBP1-81734]
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).Western Blot: LONP1 Antibody [NBP1-81734] -
nbp1-81734_rabbit-polyclonal-lonp1-antibody-2092023181153.jpgWestern Blot: LONP1 Antibody [NBP1-81734] -
Western Blot: LONP1 Antibody [NBP1-81734] - Altered mitochondrial features in cybrid cells carrying MELAS, MERRF, m.5514 A > G (mt-tRNATrp), m.1643A > G (mt-tRNAVal), & m.14487 T > C (ND6) mutations. (A) Representative western blot of LONP1, AFG3L2 & CLPP peptidases in mutant & wild type (WT) cybrid cells. The membrane was also probed with porin as a loading control. Full-length western blots & lower-exposure blots of porin are included in supplementary information. (B) Densitometric analysis of LONP1, AFG3L2 & CLPP normalized to porin & represented as fold change relative to WT (top). Quantitative data are from at least three independent experiments. Results from this analysis are also shown as a heatmap (bottom). The color & the corresponding value in log2 scale are depicted on the left. (C) Representative Blue Native-PAGE of OXPHOS complexes in mutant & WT cybrid cells. Full-length blots & lower-exposure blots for those with high contrast are included in supplementary information. (D) Densitometric analysis of OXPHOS complexes normalized to complex-II (loading control) & represented as fold change relative to WT. (E) Cellular ATP determination in mutant & WT cybrid cells. (F & G) Determination of Ca2+ (F) & ROS (G) by flow cytometry in mutant & WT cybrid cells with Fluo-3 & MitoSOX Red, respectively. All data are the mean ± SEM of at least three different experiments. Differences from WT values were found to be statistically significant at *p < 0.05, **p < 0.01 & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28740091), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for LONP1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Human Kidney, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 110, 107 kDa
See Simple Western Antibody Database for Simple Western validation: Tested in Human Kidney, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 110, 107 kDa
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LONP1
Alternate Names
EC 3.4.21, EC 3.4.21.-, EC 3.4.21.53, hLON, hLON ATP-dependent protease, LON, lon peptidase 1, mitochondrial, lon protease homolog, mitochondrial, Lon protease-like protein, LonHS, LONP, Mitochondrial ATP-dependent protease Lon, mitochondrial lon peptidase 1, mitochondrial lon protease-like protein, PIM1, protease, serine, 15, PRSS15MGC1498, Serine protease 15
Gene Symbol
LONP1
Additional LONP1 Products
Product Documents for LONP1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LONP1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for LONP1 Antibody - BSA Free
Customer Reviews for LONP1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LONP1 Antibody - BSA Free and earn rewards!
Have you used LONP1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...