LXR alpha/NR1H3 Antibody (7Z4H10)
Novus Biologicals | Catalog # NBP3-16304
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7Z4H10 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXR alpha/NR1H3 (Q13133). MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit LXR alpha/NR1H3 Antibody (7Z4H10) (NBP3-16304) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for LXR alpha/NR1H3 Antibody (7Z4H10)
Western Blot: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Western Blot: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Western blot analysis of extracts of various cell lines, using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded mouse testis using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of Hep G2 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded rat ovary using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]
Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded human colon using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] -
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] -
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Confocal imaging of C2C12 cells using LXR alpha/NR1H3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] -
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] -
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] -
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for LXR alpha/NR1H3 Antibody (7Z4H10)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: LXR alpha/NR1H3
LXR antibodies are useful for lipid and cholesterol metabolism studies.
Long Name
Liver X Receptor alpha
Alternate Names
NR1H3, RLD-1
Gene Symbol
NR1H3
Additional LXR alpha/NR1H3 Products
Product Documents for LXR alpha/NR1H3 Antibody (7Z4H10)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LXR alpha/NR1H3 Antibody (7Z4H10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for LXR alpha/NR1H3 Antibody (7Z4H10)
There are currently no reviews for this product. Be the first to review LXR alpha/NR1H3 Antibody (7Z4H10) and earn rewards!
Have you used LXR alpha/NR1H3 Antibody (7Z4H10)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...