LXR alpha/NR1H3 Antibody (7Z4H10)

Novus Biologicals | Catalog # NBP3-16304

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7Z4H10 expressed in HEK293
View all LXR alpha/NR1H3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXR alpha/NR1H3 (Q13133). MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit LXR alpha/NR1H3 Antibody (7Z4H10) (NBP3-16304) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for LXR alpha/NR1H3 Antibody (7Z4H10)

Western Blot: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Western Blot: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Western Blot: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Western blot analysis of extracts of various cell lines, using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded mouse testis using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of Hep G2 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded rat ovary using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304]

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded human colon using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
LXR alpha/NR1H3 Antibody (7Z4H10)

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] -

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LXR alpha/NR1H3 Antibody (7Z4H10)

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] -

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Confocal imaging of C2C12 cells using LXR alpha/NR1H3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
LXR alpha/NR1H3 Antibody (7Z4H10)

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] -

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LXR alpha/NR1H3 Antibody (7Z4H10)

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] -

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LXR alpha/NR1H3 Antibody (7Z4H10)

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] -

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for LXR alpha/NR1H3 Antibody (7Z4H10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LXR alpha/NR1H3

Liver X Receptors (LXRs) are oxysterol activated nuclear receptors which are involved in the regulation of cholesterol metabolism and bile acids. Two known isoforms, alpha and beta, are differentially expressed. The alpha isoform is predominantly expressed in liver, whereas the beta isoform expression has been shown to be ubiquitous.

LXR antibodies are useful for lipid and cholesterol metabolism studies.

Long Name

Liver X Receptor alpha

Alternate Names

NR1H3, RLD-1

Gene Symbol

NR1H3

Additional LXR alpha/NR1H3 Products

Product Documents for LXR alpha/NR1H3 Antibody (7Z4H10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LXR alpha/NR1H3 Antibody (7Z4H10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LXR alpha/NR1H3 Antibody (7Z4H10)

There are currently no reviews for this product. Be the first to review LXR alpha/NR1H3 Antibody (7Z4H10) and earn rewards!

Have you used LXR alpha/NR1H3 Antibody (7Z4H10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies