Lysozyme Antibody (2Y5E4)
Novus Biologicals | Catalog # NBP3-15338
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 2Y5E4 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (NP_000230.1). MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Lysozyme Antibody (2Y5E4)
Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -
Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -Analysis of paraffin-embedded Human stomach using Lysozyme (LYZ) Rabbit mAb at a dilution of 1:400 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -
Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -Analysis of Lysozyme (LYZ) in paraffin-embedded mouse kidney tissue using Lysozyme (LYZ) Rabbit mAb at a dilution of 1:900 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -
Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -Analysis of Lysozyme (LYZ) in paraffin-embedded human spleen tissue using Lysozyme (LYZ) Rabbit mAb at a dilution of 1:900 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: Lysozyme Antibody (ARQ4974) [NBP3-15338] -
Western Blot: Lysozyme Antibody (ARQ4974) [NBP3-15338] - analysis of various lysates, using Lysozyme(LYZ) antibody at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of paraffin-embedded Mouse small intestine tissue using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of paraffin-embedded Mouse kidney tissue using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of RAW 264.7 cells using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of paraffin-embedded Mouse lung tissue using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunofluorescence analysis of paraffin-embedded Human stomach tissue using Lysozyme Rabbit mAb at a dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] -
Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Applications for Lysozyme Antibody (2Y5E4)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Immunocytochemistry/ Immunofluorescence
1:200 - 1:2000
Immunohistochemistry
1:1000 - 1:10000
Immunohistochemistry-Paraffin
1:1000 - 1:10000
Western Blot
1:3000 - 1:20000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Lysozyme
Alternate Names
EC 3.2.1.17, lysozyme, lysozyme (renal amyloidosis)1,4-beta-N-acetylmuramidase C, lysozyme C, LZM, renal amyloidosis
Gene Symbol
LYZ
Additional Lysozyme Products
Product Documents for Lysozyme Antibody (2Y5E4)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Lysozyme Antibody (2Y5E4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Lysozyme Antibody (2Y5E4)
There are currently no reviews for this product. Be the first to review Lysozyme Antibody (2Y5E4) and earn rewards!
Have you used Lysozyme Antibody (2Y5E4)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...