MAP2 Antibody

Novus Biologicals | Catalog # NBP1-81264

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG
View all MAP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids:SLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVK

Marker

Neuronal Dendritic Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAP2 Antibody

Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264] - Immunohistochemical staining of human small intestine shows no cytoplasmic positivity as expected.
Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264] - Immunohistochemistry analysis in human cerebral cortex and small intestine tissues using NBP1-81264 antibody. Corresponding MAP2 RNA-seq data are presented for the same tissues.
Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity..
Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264]

Immunohistochemistry: MAP2 Antibody [NBP1-81264] - Immunohistochemical staining of human pancreas shows moderate to strong cytoplasmic positivity in islets of Langerhans.
Immunofluorescence: MAP2 Antibody [NBP1-81264]

Immunofluorescence: MAP2 Antibody [NBP1-81264]

Immunofluorescence: MAP2 Antibody [NBP1-81264] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Applications for MAP2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAP2

Microtubule-associated protein 2 also known as MAP2 (theoretical molecular weight 280 kDa) belongs to the MAP2/Tau family which in addition to the two neuronal forms MAP2 and Tau also includes MAP4 (1). For MAP2, four different isoforms have been identified which are produced through alternative splicing including MAP2a, MAP2b, MAP2c and MAP2d (1). MAP2 isoforms contain multiple microtubule-binding domains located near the carboxy terminal, a variably sized amino-terminal projection domain, and a conserved protein kinase A binding domain. MAP2c and MAP2d isoforms have a shorter amino-terminal projection domain, lower molecular weight and are identifiable at ~70 kDa in SDS-PAGE analysis (2,3). MAP2's carboxy terminal domain supports interactions with microtubules, actin, and intermediate filaments (2).

MAP2 isoforms are developmentally regulated and differentially expressed in neurons and some glia. MAP2c is predominantly expressed in the developing brain while the other isoforms are expressed in the adult brain. The distribution of MAP2 isoforms also varies, with MAP2a and MAP2b predominantly localized to dendrites, while MAP2c is also found in axons. Lastly, the expression of MAP2d is not limited to neurons and may be found in glia, specifically oligodendrocytes (1, 2). MAP2 isoforms associate with microtubules and mediate their interaction with actin filaments thereby playing a critical role in organizing the microtubule-actin network. In neurons, MAP2 isoforms are implicated in different processes including neurite initiation, elongation and stabilization as well as axon and dendrite formation (2). Knockout of MAP expression in animal models results in a variety of functional and structural brain defects according to the isoform affected (e.g., reduced LTP and LTD, reduced myelination, absence of corpus collosum, motor system malfunction, abnormal hippocampal dendritic morphology, abnormal synaptic plasticity) (4).

References

1. Dehmelt, L., & Halpain, S. (2005). The MAP2/Tau family of microtubule-associated proteins. Genome Biology. https://doi.org/10.1186/gb-2004-6-1-204

2. Mohan, R., & John, A. (2015). Microtubule-associated proteins as direct crosslinkers of actin filaments and microtubules. IUBMB Life. https://doi.org/10.1002/iub.1384

3. Shafit-Zagardo, B., & Kalcheva, N. (1998). Making sense of the multiple MAP-2 transcripts and their role in the neuron. Molecular Neurobiology. https://doi.org/10.1007/BF02740642

4. Tortosa, E., Kapitein, L. C., & Hoogenraad, C. C. (2016). Microtubule organization and microtubule-associated proteins (MAPs). In Dendrites: Development and Disease. https://doi.org/10.1007/978-4-431-56050-0_3

Long Name

Microtubule-associated Protein 2

Alternate Names

DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2

Gene Symbol

MAP2

Additional MAP2 Products

Product Documents for MAP2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAP2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAP2 Antibody

There are currently no reviews for this product. Be the first to review MAP2 Antibody and earn rewards!

Have you used MAP2 Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies