MARCKS Antibody (2C2) - Azide and BSA Free

Novus Biologicals | Catalog # H00004082-M06

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2C2

Format

Azide and BSA Free
View all MARCKS Primary Antibodies »

Product Specifications

Immunogen

MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

MARCKS - myristoylated alanine-rich protein kinase C substrate

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MARCKS Antibody (2C2) - Azide and BSA Free

Western Blot: MARCKS Antibody (2C2) [H00004082-M06]

Western Blot: MARCKS Antibody (2C2) [H00004082-M06]

Western Blot: MARCKS Antibody (2C2) [H00004082-M06] - Analysis of MARCKS expression in Raw 264.7. (The predicted M.W. of MARCKS is 29 to 39 KDa, but it seems the actual M.W. in vivois between 68 to 90 KDa in different species.)
Immunocytochemistry/ Immunofluorescence: MARCKS Antibody (2C2) [H00004082-M06]

Immunocytochemistry/ Immunofluorescence: MARCKS Antibody (2C2) [H00004082-M06]

Immunocytochemistry/Immunofluorescence: MARCKS Antibody (2C2) [H00004082-M06] - Analysis of monoclonal antibody to MARCKS on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: MARCKS Antibody (2C2) [H00004082-M06]

Immunohistochemistry-Paraffin: MARCKS Antibody (2C2) [H00004082-M06]

Immunohistochemistry-Paraffin: MARCKS Antibody (2C2) [H00004082-M06] - Analysis of monoclonal antibody to MARCKS on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml
ELISA: MARCKS Antibody (2C2) [H00004082-M06]

ELISA: MARCKS Antibody (2C2) [H00004082-M06]

ELISA: MARCKS Antibody (2C2) [H00004082-M06] - Detection limit for recombinant GST tagged MARCKS is approximately 0.03ng/ml as a capture antibody.

Applications for MARCKS Antibody (2C2) - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MARCKS

The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis.

Long Name

Myristoylated Alanine-rich Protein Kinase C Substrate

Alternate Names

80K-L, MACS, PRKCSL

Entrez Gene IDs

4082 (Human)

Gene Symbol

MARCKS

OMIM

177061 (Human)

UniProt

NP_002347 (Human)

Additional MARCKS Products

Product Documents for MARCKS Antibody (2C2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MARCKS Antibody (2C2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Intracellular Kinases

Customer Reviews for MARCKS Antibody (2C2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MARCKS Antibody (2C2) - Azide and BSA Free and earn rewards!

Have you used MARCKS Antibody (2C2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MARCKS Antibody (2C2) - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I need technical information about the MARCKS antibody 2C2 (H00004082-M06). I would like to have more information about the immunogen used. Are the aa corresponding to the effector domain?

    A: The immunogen for this antibody is 'MARCKS (NP_002347, 2 a.a. - 66 a.a) partial recombinant protein with GST tag. GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKV NGDASPAAAESGAKEELQANGSAP'. The MARCKS effector domain corresponds to amino acids 151-175, KKKKKRFSFKKSFKLSGFSFKKNKK-NH (see JBC and PMC) for more information). Therefore, the answer is no.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies