MCPIP1/ZC3H12A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37871

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCPIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MCPIP1/ZC3H12A Antibody - BSA Free

Western Blot: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Western Blot: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Western Blot: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Analysis in control (vector only transfected HEK293T lysate) and ZC3H12A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunocytochemistry/ Immunofluorescence: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunocytochemistry/Immunofluorescence: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human cell line U-251 MG shows localization to cytoplasmic bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human colon shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871]

Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in Leydig cells.
MCPIP1/ZC3H12A Antibody - BSA Free Chromatin Immunoprecipitation ChIP: MCPIP1/ZC3H12A Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: MCPIP1/ZC3H12A Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-MCPIP1/ZC3H12A tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for MCPIP1/ZC3H12A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCPIP1

Monocyte chemoattractant protein-induced protein 1 (MCPIP1), also referred to as ZC3H12A and Regnase-1, is an endonuclease that cleaves and destabilizes mRNA and functions as a negative regulator of inflammation (1,2). MCPIP1 is encoded by the ZC3H12A gene as a protein of 599 amino acids (aa) in length with a theoretical molecular weight of approximately 66 kDa (3-5). Common structural features of the MCPIP1 protein are the ubiquitin-associated (UBA) domain (43-89 aa), two protein-rich regions (PRRs) (100-126 aa, 458-536 aa), the PilT N-terminal (PIN) domain (133-270 aa), the zinc-finger motif (305-325 aa), the natively disordered region (326-457 aa), and the C-terminal conserved region (CCR) (545-598 aa) (1,3-5). MCPIP1 functions as an anti-inflammatory protein with RNase activity that is known to degrade many cytokine mRNA transcripts including interleukin-1beta (IL-1beta), IL-6, and IL-17 (4,5). In addition to its regulation of inflammation through mRNA degradation, MCPIP1 also controls inflammation through ubiquitin-specific peptidase 10 (USP10)-mediated protein deubiquitination of TRAF6 which results in suppression of c-Jun N-terminal kinase (JNK) and nuclear factor kappa B (NFkappaB) transcription factors (1,2,5). Besides regulating inflammation, MCPIP1 is involved in several non-immune cellular processes including apoptosis, adipogenesis, angiogenesis, and proliferation (2,5). MCPIP1 has also been implicated in a number of autoimmune diseases and other pathologies including chronic obstructive pulmonary disease (COPD), diabetes, rheumatoid arthritis, and cancer (3,5). Additionally, MCPIP1/ZC3H12A has been shown to have anti-viral activity against RNA viruses such as Japanese encephalitis virus and human immunodeficiency virus (HIV)-1 (1,5).

References

1. Uehata, T., & Takeuchi, O. (2017). Regnase-1 Is an Endoribonuclease Essential for the Maintenance of Immune Homeostasis. Journal of interferon & cytokine research: the official journal of the International Society for Interferon and Cytokine Research, 37(5), 220-229. https://doi.org/10.1089/jir.2017.0001

2. Miekus, K., Kotlinowski, J., Lichawska-Cieslar, A., Rys, J., & Jura, J. (2019). Activity of MCPIP1 RNase in tumor associated processes. Journal of experimental & clinical cancer research : CR, 38(1), 421. https://doi.org/10.1186/s13046-019-1430-6

3. Jura, J., Skalniak, L., & Koj, A. (2012). Monocyte chemotactic protein-1-induced protein-1 (MCPIP1) is a novel multifunctional modulator of inflammatory reactions. Biochimica et biophysica acta, 1823(10), 1905-1913. https://doi.org/10.1016/j.bbamcr.2012.06.029

4. Xu, J., Fu, S., Peng, W., & Rao, Z. (2012). MCP-1-induced protein-1, an immune regulator. Protein & cell, 3(12), 903-910. https://doi.org/10.1007/s13238-012-2075-9

5. Musson, R., Szukala, W., & Jura, J. (2020). MCPIP1 RNase and Its Multifaceted Role. International journal of molecular sciences, 21(19), 7183. https://doi.org/10.3390/ijms21197183

Long Name

MCP-1-induced Protein 1

Alternate Names

ZC3H12A

Gene Symbol

ZC3H12A

UniProt

Q5D1E8 (Human)

Additional MCPIP1 Products

Product Documents for MCPIP1/ZC3H12A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCPIP1/ZC3H12A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

NFkB Pathway
Translation Regulation

Customer Reviews for MCPIP1/ZC3H12A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCPIP1/ZC3H12A Antibody - BSA Free and earn rewards!

Have you used MCPIP1/ZC3H12A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies