MCT1/SLC16A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89574

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MCT1/SLC16A1 Antibody - BSA Free

Western Blot: MCT1/SLC16A1 Antibody [NBP1-89574]

Western Blot: MCT1/SLC16A1 Antibody [NBP1-89574]

Western Blot: MCT1/SLC16A1 Antibody [NBP1-89574] - Analysis in human cell lines HEK293 and MCF-7 using anti-SLC16A1 antibody. Corresponding SLC16A1 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
MCT1/SLC16A1 Antibody - BSA Free Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody - BSA Free [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody - BSA Free [NBP1-89574]

Analysis in human testis and pancreas tissues using NBP1-89574 antibody. Corresponding SLC16A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
MCT1/SLC16A1 Antibody - BSA Free Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody - BSA Free [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody - BSA Free [NBP1-89574]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574] - Staining of human colon shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.
MCT1/SLC16A1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: MCT1/SLC16A1 Antibody [NBP1-89574]

Immunocytochemistry/ Immunofluorescence: MCT1/SLC16A1 Antibody [NBP1-89574]

Staining of human cell line U-251 MG shows localization to plasma membrane.

Applications for MCT1/SLC16A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCT1/SLC16A1

The SLC16A1 gene encodes a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT (Garcia et al., 1994 [PubMed 8124722]).[supplied by OMIM]

Long Name

Monocarboxylic Acid Transporter 1 (Solute Carrier Family 16 Member 1)

Alternate Names

HHF7, SLC16A1

Gene Symbol

SLC16A1

Additional MCT1/SLC16A1 Products

Product Documents for MCT1/SLC16A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCT1/SLC16A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MCT1/SLC16A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCT1/SLC16A1 Antibody - BSA Free and earn rewards!

Have you used MCT1/SLC16A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies