Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03633

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human Melatonin R1A/MT1/MTNR1A (NP_005949.1). YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Mouse brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Rat brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).
Melatonin R1A/MT1/MTNR1A Antibody

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] -

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - analysis of Mouse eye, using MTNR1A antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Applications for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:100-1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Melatonin R1A/MT1/MTNR1A

Melatonin Receptor 1A encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]

Long Name

Melatonin Receptor 1A

Alternate Names

Mel-1A-R, MelatoninR1A, MT1, MTNR1A

Gene Symbol

MTNR1A

Additional Melatonin R1A/MT1/MTNR1A Products

Product Documents for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Customer Reviews for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free and earn rewards!

Have you used Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.

    A:

    At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...