Methionine Sulfoxide Reductase A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38255

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 24-235 of human Methionine Sulfoxide Reductase A (NP_036463.1).

Sequence:
GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Methionine Sulfoxide Reductase A Antibody - BSA Free

Methionine Sulfoxide Reductase A Antibody

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] -

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunofluorescence analysis of NIH/3T3 cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Methionine Sulfoxide Reductase A Antibody

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] -

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Western blot analysis of various lysates using Methionine Sulfoxide Reductase A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Methionine Sulfoxide Reductase A Antibody

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] -

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunofluorescence analysis of PC-12 cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Methionine Sulfoxide Reductase A Antibody

Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] -

Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Methionine Sulfoxide Reductase A Antibody

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] -

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunofluorescence analysis of U2OS cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Methionine Sulfoxide Reductase A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 - 1:500

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Methionine Sulfoxide Reductase A

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase

Gene Symbol

MSRA

Additional Methionine Sulfoxide Reductase A Products

Product Documents for Methionine Sulfoxide Reductase A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Methionine Sulfoxide Reductase A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Methionine Sulfoxide Reductase A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Methionine Sulfoxide Reductase A Antibody - BSA Free and earn rewards!

Have you used Methionine Sulfoxide Reductase A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...